Align glyoxylate reductase (EC 1.1.1.26); 4-hydroxybutyrate dehydrogenase (EC 1.1.1.61); glyoxylate reductase (NADP+) (EC 1.1.1.79) (characterized)
to candidate WP_008484309.1 B3C1_RS08870 NAD(P)-dependent oxidoreductase
Query= BRENDA::Q9LSV0 (289 letters) >NCBI__GCF_000299915.1:WP_008484309.1 Length = 291 Score = 141 bits (355), Expect = 2e-38 Identities = 92/282 (32%), Positives = 139/282 (49%), Gaps = 4/282 (1%) Query: 1 MEVGFLGLGIMGKAMSMNLLKNGFKVTVWNRTLSKCDELVEHGASVCESPAEVIKKCKYT 60 M+VGF+GLG MGK M+ NL+K GF + VWNR+ + +LV GA + P + + Sbjct: 1 MKVGFIGLGTMGKPMAANLIKAGFSLKVWNRSQAPVQDLVALGAEAAKGPGD-FAEVDVL 59 Query: 61 IAMLSDPCAALSVVFDKGGVLEQICEGKGYIDMSTVDAETSLKINEAITGKGGRFVEGPV 120 +MLSD SVV D GG + G +++M+T+ + + + +G +V PV Sbjct: 60 ASMLSDDATVQSVVVD-GGAQASLKAGAIHLNMATISLALAQSLAASHQQQGIGYVAAPV 118 Query: 121 SGSKKPAEDGQLIILAAGDKALFEESIPAFDVLGKRSFYLG-QVGNGAKMKLIVNMIMGS 179 G AE G L ILAAG + P D +G+++++ G Q +KL N + S Sbjct: 119 LGRVNVAEAGMLNILAAGQGEHLAKVAPLLDAMGQKTWHFGDQPAQANVVKLAANFCLAS 178 Query: 180 MMNAFSEGLVLADKSGLSSDTLLDILDLGAMTNPMFKGKGPSMNKSSYPPA-FPLKHQQK 238 + E L G S + +L P ++ G + + Y PA F L K Sbjct: 179 AIETMGEASALVQAHGGSGSGFIQMLTSTLFAAPAYQNYGAMIAEQRYQPAGFKLSLGLK 238 Query: 239 DMRLALALGDENAVSMPVAAAANEAFKKARSLGLGDLDFSAV 280 D+RLAL G+ V MP A+ + F A + G GDLD++A+ Sbjct: 239 DVRLALEAGEAGQVPMPFASTMKDNFLDAMAQGDGDLDWAAL 280 Lambda K H 0.317 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 197 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 291 Length adjustment: 26 Effective length of query: 263 Effective length of database: 265 Effective search space: 69695 Effective search space used: 69695 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory