Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate WP_008486155.1 B3C1_RS16220 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD
Query= metacyc::MONOMER-20835 (262 letters) >NCBI__GCF_000299915.1:WP_008486155.1 Length = 249 Score = 96.3 bits (238), Expect = 6e-25 Identities = 76/253 (30%), Positives = 118/253 (46%), Gaps = 21/253 (8%) Query: 12 GLRVLISGGAAGIGEVLAAAYLEAGAQVHV-------CDVSESALAVFRDKYPGTVATRA 64 G R L++G + G+G+ +A E GA+V CD + + + K A A Sbjct: 6 GKRALVTGASRGLGQAMALGLAENGAEVICASSREGGCDDTVAKILALGGK---ARALAA 62 Query: 65 DVSDAAQIEAVFKVQREHLGGLDVLVNNAGIAGPTGGIDAISDAEWQATININLTAQYRF 124 D+ D+ ++A+ + Q G +DVLVNN G +D DA + A I +NL A ++ Sbjct: 63 DLGDSQAVQALAE-QALAAGPVDVLVNNGGCIYREAALDFPLDA-FDAVIKVNLNAAFQL 120 Query: 125 AHHAVPMLKESSHGHLLHIASVAGRLGYAWRTPYAATKWAIVGLMKSLASELGESDIRVN 184 + + G +++IAS+ G Y A+K AI GL K+LA+E G+ I+VN Sbjct: 121 SQLLGRAMVTKGSGKIVNIASMLSYSGGIRVPAYTASKHAIAGLTKALANEWGQHGIQVN 180 Query: 185 ALLPGIVEGPRMDGVIRARAEQVGVPEAEMRQEYLNKISLKRMVTAEDVAAMALFLCSPA 244 A+ P G R Q +AE E +I R +D+ +FL S A Sbjct: 181 AIAP---------GYFRTDNTQALQDDAERSSEIEKRIPAGRWGNPDDLKGAVVFLASKA 231 Query: 245 ARNVTGQAISVDG 257 + V G ++VDG Sbjct: 232 SDYVNGHILAVDG 244 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 249 Length adjustment: 24 Effective length of query: 238 Effective length of database: 225 Effective search space: 53550 Effective search space used: 53550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory