Align Short-chain dehydrogenase/reductase SDR (characterized, see rationale)
to candidate WP_008484313.1 B3C1_RS08890 SDR family oxidoreductase
Query= uniprot:B2T9V3 (247 letters) >NCBI__GCF_000299915.1:WP_008484313.1 Length = 264 Score = 117 bits (293), Expect = 2e-31 Identities = 83/260 (31%), Positives = 126/260 (48%), Gaps = 18/260 (6%) Query: 1 MTQRLAGKTALITAAGQGIGLATAELFAREGARVIA---TDIRID---GLAGKPVEARKL 54 M L GK A++T + GIGLATA+ A GA+V+ T ++D G V +L Sbjct: 1 MKIELQGKLAIVTGSTLGIGLATAKGLAACGAKVVVNGRTQAKVDKAVAAIGAAVPGAQL 60 Query: 55 -----DVRDDAAIKALAAEIGAVDVLFNCAGFVHAGNILECSEEDWDFAFDLNVKAMYRM 109 D+ L A + A D+L N AG + + W FD+NV + R+ Sbjct: 61 LGVAADLASAEGCDKLVAAVPACDILVNNAGIFAPQEFFDTPDSQWQHFFDVNVMSGMRL 120 Query: 110 IRAFLPAMLDKGGGSIINMSSAASSVKGVP-NRFAYSASKAAVIGLTKSVAADFITRGVR 168 RA+LPAM KG G ++ + S S +P + Y +K AV+ L++ +A GV Sbjct: 121 SRAYLPAMAAKGWGRVVFLGS--ESALNIPEDMIHYGMTKTAVLALSRGLAKRMRESGVT 178 Query: 169 CNAICPGTVASPSLEQRIVAQAQAQGATLDAVQAAFV----ARQPMGRIGKPEEIAALAL 224 NA+ PG S +E + + G +++ V FV +GR+ EE+A L + Sbjct: 179 VNAVLPGPTLSEGVEAMLAEEVAHSGKSIEEVGRDFVKVLRPSSIIGRLASCEEVANLIV 238 Query: 225 YLGSDESSFTTGHAHVIDGG 244 Y S+++S TTG A +DGG Sbjct: 239 YTCSEQASATTGAALRVDGG 258 Lambda K H 0.320 0.133 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 4 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 264 Length adjustment: 24 Effective length of query: 223 Effective length of database: 240 Effective search space: 53520 Effective search space used: 53520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory