Align Galactofuranose-binding protein YtfQ (characterized)
to candidate WP_156804529.1 B3C1_RS10875 substrate-binding domain-containing protein
Query= SwissProt::P39325 (318 letters) >NCBI__GCF_000299915.1:WP_156804529.1 Length = 309 Score = 330 bits (846), Expect = 3e-95 Identities = 174/301 (57%), Positives = 222/301 (73%), Gaps = 5/301 (1%) Query: 14 AMSSMALAAPLTVGFSQVGSESGWRAAETNVAKSEAEKRGITLKIADGQQKQENQIKAVR 73 A+S ALA +TVGFSQVGSESGWR++ + K EA+ RGI LK ADGQQKQENQI+AVR Sbjct: 14 ALSHSALA--ITVGFSQVGSESGWRSSFSQDMKDEAKSRGIDLKFADGQQKQENQIRAVR 71 Query: 74 SFVAQGVDAIFIAPVVATGWEPVLKEAKDAEIPVFLLDRSIDVKDKSLYMTTVTADNILE 133 SF+AQGVDAI IAPVV TGW PVLKEAK A IPV +LDR+I + LY+T + +D E Sbjct: 72 SFIAQGVDAIIIAPVVETGWTPVLKEAKRARIPVVILDRNIKAAE-GLYVTRIASDFTEE 130 Query: 134 GKLIGDWLVKEVNGKPCNVVELQGTVGASVAIDRKKGFAEAIKNAPNIKIIRSQSGDFTR 193 G+ WL+ + G+ CN+VELQGTVGA+ AIDR KGF E I P KI+RSQ+ +FTR Sbjct: 131 GRKAARWLMDKTKGQ-CNIVELQGTVGATAAIDRAKGFNEVIGAYPQAKIVRSQTAEFTR 189 Query: 194 SKGKEVMESFIKAENNGKNICMVYAHNDDMVIGAIQAIKEAGLKPGKDILTGSIDGVPDI 253 +KGKEVMESF+KAE + +++C +++HND+M +GAIQAIKEAGLKPGKD+L S+DGVPD Sbjct: 190 AKGKEVMESFLKAE-DPQSLCALWSHNDEMALGAIQAIKEAGLKPGKDLLVVSVDGVPDY 248 Query: 254 YKAMMDGEANASVELTPNMAGPAFDALEKYKKDGTMPEKLTLTKSTLYLPDTAKEELEKK 313 +KAM +G+AN +VEL P++ PA+ +EK KL T ++ DTA E +K+ Sbjct: 249 FKAMAEGDANITVELNPHLGAPAYQVVEKVLAGDKGIPKLISTTGEVFGQDTAATEYQKR 308 Query: 314 K 314 K Sbjct: 309 K 309 Lambda K H 0.313 0.130 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 304 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 309 Length adjustment: 27 Effective length of query: 291 Effective length of database: 282 Effective search space: 82062 Effective search space used: 82062 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory