Align N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)
to candidate WP_008482959.1 B3C1_RS03530 ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF2754 (331 letters) >NCBI__GCF_000299915.1:WP_008482959.1 Length = 235 Score = 117 bits (292), Expect = 4e-31 Identities = 71/204 (34%), Positives = 109/204 (53%), Gaps = 8/204 (3%) Query: 15 PVEVLKDINLTVEDGEFVVFVGPSGCGKSTLLRVISGLEDATAGEISIGGQTVTTTPPAK 74 P L+ I+LT+ +++ +GPSG GKSTLL ++ L+ + G + G+ V T P ++ Sbjct: 20 PFWALRGIDLTIGRNDYLAIIGPSGSGKSTLLNILGCLDVPSEGHYWLAGEDVATLPQSQ 79 Query: 75 RG------IAMVFQSYALYPHLSVRENMALALKQERQPKEEIAARVAEASRMLSLEDYLD 128 I +FQS+ L P S +N+A L + +E R EA + L D + Sbjct: 80 LARVRNHQIGFIFQSFNLLPRASALDNVAQPLVYQGFSLKERRQRALEALAKVGLADRAN 139 Query: 129 RRPSELSGGQRQRVAIGRAVVREPKLFLFDEPLSNLDAALRMNTRLEIARLHRQLSASMI 188 RP++LSGGQRQRVAI RA+V P + L DEP NLD+ + LH + +++ Sbjct: 140 HRPNQLSGGQRQRVAIARALVTRPSILLADEPTGNLDSQTTRDIMALFDELHGE-GQTIV 198 Query: 189 YVTHDQIEAMTLADKIVVLRDGRI 212 VTH+Q + ++V + DG I Sbjct: 199 VVTHEQ-DIANHCRRVVRVMDGVI 221 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 235 Length adjustment: 25 Effective length of query: 306 Effective length of database: 210 Effective search space: 64260 Effective search space used: 64260 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory