Align GDP-6-deoxy-D-talose 4-dehydrogenase (EC 1.1.1.135); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC 1.1.1.178) (characterized)
to candidate WP_008484996.1 B3C1_RS11585 3-oxoacyl-ACP reductase FabG
Query= BRENDA::Q99714 (261 letters) >NCBI__GCF_000299915.1:WP_008484996.1 Length = 243 Score = 117 bits (292), Expect = 3e-31 Identities = 81/255 (31%), Positives = 126/255 (49%), Gaps = 16/255 (6%) Query: 7 SVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVT 66 S+ G +A++TG + G+G A AERL QGA+ + G EA + LG +VT Sbjct: 2 SLTGKIALVTGASRGIGRAIAERLAAQGATVFGTATSDKGAEAISSYLGEGRGLN-LNVT 60 Query: 67 SEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTF 126 S + LA K + G +D+ VN AGI + +K E++ V+D NL + Sbjct: 61 SSDSIDAVLATVKDRAGDLDILVNNAGITRDNLLMRMKD------EEWDEVIDTNLKSLY 114 Query: 127 NVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDL 186 + + V M + + G II+ SV G GQ Y+A+K G++G T +AR++ Sbjct: 115 RLSKAVLRPMMKK------RAGRIISVGSVVGTMGNQGQVNYAAAKAGLLGFTKSLAREV 168 Query: 187 APIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENP-- 244 A I V +APG T + L + + + QVP +RLG PAE A V + N Sbjct: 169 ASRNITVNAVAPGFIDTDMTRELTDDQKSAIFGQVPL-ARLGSPAEIASAVVFLASNEAG 227 Query: 245 FLNGEVIRLDGAIRM 259 ++ GE + ++G + M Sbjct: 228 YITGETLHVNGGMVM 242 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 243 Length adjustment: 24 Effective length of query: 237 Effective length of database: 219 Effective search space: 51903 Effective search space used: 51903 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory