Align Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale)
to candidate WP_008482959.1 B3C1_RS03530 ABC transporter ATP-binding protein
Query= uniprot:Q88GX0 (260 letters) >NCBI__GCF_000299915.1:WP_008482959.1 Length = 235 Score = 149 bits (377), Expect = 4e-41 Identities = 88/207 (42%), Positives = 125/207 (60%), Gaps = 4/207 (1%) Query: 33 FHVLRDIDLQVREGERIVLCGPSGSGKSTLIRCINRLEVAQQGSIQVDGIDLAATTR-EA 91 F LR IDL + + + + GPSGSGKSTL+ + L+V +G + G D+A + + Sbjct: 21 FWALRGIDLTIGRNDYLAIIGPSGSGKSTLLNILGCLDVPSEGHYWLAGEDVATLPQSQL 80 Query: 92 AQVRS-DIGMVFQHFNLFPHMSVLDNCLLAPTSVRGLSRKDAEERARMYLSKVGIESQAH 150 A+VR+ IG +FQ FNL P S LDN + P +G S K+ +RA L+KVG+ +A+ Sbjct: 81 ARVRNHQIGFIFQSFNLLPRASALDN-VAQPLVYQGFSLKERRQRALEALAKVGLADRAN 139 Query: 151 KYPSQLSGGQQQRVAIARALCMKPRIMLFDEPTSALDPEMVAEVLDVLVQLAGTGMTMLC 210 P+QLSGGQ+QRVAIARAL +P I+L DEPT LD + +++ + +L G G T++ Sbjct: 140 HRPNQLSGGQRQRVAIARALVTRPSILLADEPTGNLDSQTTRDIMALFDELHGEGQTIVV 199 Query: 211 VTHEMGFARQVAERVLFLEGGQIIEDS 237 VTHE A RV+ + G I DS Sbjct: 200 VTHEQDIANH-CRRVVRVMDGVITSDS 225 Lambda K H 0.322 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 235 Length adjustment: 24 Effective length of query: 236 Effective length of database: 211 Effective search space: 49796 Effective search space used: 49796 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory