Align L-rhamnose-1-dehydrogenase ( EC 1.1.1.173) (characterized)
to candidate WP_008483001.1 B3C1_RS03700 3-oxoacyl-ACP reductase FabG
Query= reanno::BFirm:BPHYT_RS28235 (260 letters) >NCBI__GCF_000299915.1:WP_008483001.1 Length = 241 Score = 130 bits (327), Expect = 3e-35 Identities = 89/250 (35%), Positives = 128/250 (51%), Gaps = 11/250 (4%) Query: 6 KVVIVTGGSRGIGRAIAVACAAEGADVAINYWGDNDVSYGRRSAVAEVVAEIEALGRRVI 65 K ++VTG SRGIG AIA AAEG V I+Y R+ A V AEIEA G + Sbjct: 2 KRILVTGASRGIGAAIAKTLAAEGIAVVIHY-------RNRQDAALAVQAEIEAAGGQAS 54 Query: 66 AIEGNVAARETGQQLVRHTVEAFGKVDVLASNAGICPFHAFLDMPPEVLESTVAVNLNGA 125 + +V+ R + + + A G + NAGI AF + + +S + NL+G Sbjct: 55 LLAFDVSDRAAAKAALEADMAANGPYYGVVVNAGITRDGAFPALTDDDWDSVIHTNLDGF 114 Query: 126 FYVTQAAAQQMKLQGTGGAIVATSSISALVGGGMQTHYTPTKAGVHSLMQSCAVALGPYG 185 + V + M GG IV +S+S L+G Q +Y+ +KAG+ ++ A+ L Sbjct: 115 YNVLKPVVMPMVQGRKGGRIVTLASVSGLIGNRGQVNYSASKAGIIGATKALALELAKRK 174 Query: 186 IRCNSVMPGTIATDLNAQDLADEAKKAYFEKRIPLGRLGRPEDVADCVTFLASDRARYVT 245 I N V PG I +D+ A+ E + IPL R G+ ++VAD V FL SD+A Y+T Sbjct: 175 ITVNCVAPGLIESDMTAELEHGE----HIVDLIPLRRAGQAQEVADAVAFLCSDKAGYIT 230 Query: 246 GAALLVDGGL 255 L V+GGL Sbjct: 231 RQVLAVNGGL 240 Lambda K H 0.319 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 241 Length adjustment: 24 Effective length of query: 236 Effective length of database: 217 Effective search space: 51212 Effective search space used: 51212 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory