Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate WP_008482959.1 B3C1_RS03530 ABC transporter ATP-binding protein
Query= reanno::Dino:3607124 (338 letters) >NCBI__GCF_000299915.1:WP_008482959.1 Length = 235 Score = 121 bits (304), Expect = 2e-32 Identities = 70/183 (38%), Positives = 102/183 (55%), Gaps = 7/183 (3%) Query: 18 ALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGRIEIGGRDVTTVEPA---- 73 AL I+L I +++ +GPSG GKSTLL L L+ S G + G DV T+ + Sbjct: 23 ALRGIDLTIGRNDYLAIIGPSGSGKSTLLNILGCLDVPSEGHYWLAGEDVATLPQSQLAR 82 Query: 74 --DRDLAMVFQSYALYPHMTVRENMEFGMKVNGFEPDLRKERIAEAARVLQLEDYLDRKP 131 + + +FQS+ L P + +N+ + GF R++R EA + L D + +P Sbjct: 83 VRNHQIGFIFQSFNLLPRASALDNVAQPLVYQGFSLKERRQRALEALAKVGLADRANHRP 142 Query: 132 GQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVELEGLHKQLGATMIYVT 191 QLSGGQRQRVAI RA+V PS+ L DEP NLD++ + + LH + G T++ VT Sbjct: 143 NQLSGGQRQRVAIARALVTRPSILLADEPTGNLDSQTTRDIMALFDELHGE-GQTIVVVT 201 Query: 192 HDQ 194 H+Q Sbjct: 202 HEQ 204 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 235 Length adjustment: 26 Effective length of query: 312 Effective length of database: 209 Effective search space: 65208 Effective search space used: 65208 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory