Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate WP_008482959.1 B3C1_RS03530 ABC transporter ATP-binding protein
Query= uniprot:D8IPI1 (406 letters) >NCBI__GCF_000299915.1:WP_008482959.1 Length = 235 Score = 112 bits (281), Expect = 8e-30 Identities = 80/223 (35%), Positives = 116/223 (52%), Gaps = 12/223 (5%) Query: 1 MADIHC-QALAKHYA-GGPP--VLHPLDLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDI 56 M D+ C +A+ K + G P L +DL IG +++ ++GPSG GKST+L ++ L+ Sbjct: 1 MTDVICLEAIKKAFVMAGEPFWALRGIDLTIGRNDYLAIIGPSGSGKSTLLNILGCLDVP 60 Query: 57 SGGTLRIGGTVVNDLP----ARERN--VAMVFQNYALYPHMSVYDNIAFGLRRLKRPAAE 110 S G + G V LP AR RN + +FQ++ L P S DN+A L E Sbjct: 61 SEGHYWLAGEDVATLPQSQLARVRNHQIGFIFQSFNLLPRASALDNVAQPLVYQGFSLKE 120 Query: 111 IDRRVREVAALLNLEALLERKPRAMSGGQQQRAAIARAIIKTPSVFLFDEPLSNLDAKLR 170 +R E A + L +P +SGGQ+QR AIARA++ PS+ L DEP NLD++ Sbjct: 121 RRQRALEALAKVGLADRANHRPNQLSGGQRQRVAIARALVTRPSILLADEPTGNLDSQTT 180 Query: 171 AQLRGDIKRLHQRLRTTTVYVTHDQLEAMTLADRVILMQDGRI 213 + LH +T V VTH+Q + RV+ + DG I Sbjct: 181 RDIMALFDELHGEGQTIVV-VTHEQ-DIANHCRRVVRVMDGVI 221 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 235 Length adjustment: 27 Effective length of query: 379 Effective length of database: 208 Effective search space: 78832 Effective search space used: 78832 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory