Align Glyoxylate reductase; EC 1.1.1.26 (characterized)
to candidate WP_008485733.1 B3C1_RS14495 D-glycerate dehydrogenase
Query= SwissProt::Q9C4M5 (331 letters) >NCBI__GCF_000299915.1:WP_008485733.1 Length = 337 Score = 249 bits (637), Expect = 5e-71 Identities = 148/329 (44%), Positives = 205/329 (62%), Gaps = 10/329 (3%) Query: 1 MKPKVFITRQIPENGIKMIEKFYEIELWKDPKAPPRGVLLEKVREVDALVTLVTDKVDKE 60 MKP+VF+ ++ + +E Y++ DPK +G + V ++ + + E Sbjct: 1 MKPQVFVFSRLKPPFLAELEAHYQVTQL-DPKGDIQGQYAAALPHVQGMIGVGRPLGEAE 59 Query: 61 LLENAPKLKIIAQYAVGYDNIDIEEATKRGIYVTNTPGVLTDATADLAFALLLAVARRIV 120 L + A +LK+I+ +VGYDN D+ R I +TNTP VLT+ TADL FALL++ ARR+ Sbjct: 60 LAQ-AGQLKVISSVSVGYDNYDLPYLNSRSIMLTNTPDVLTETTADLGFALLMSAARRLP 118 Query: 121 EADAFVRSGEWKKSEVGWHPLMFLGYGLKGKTLGIVGFGRIGQALAKRAK-GFGMKIIYY 179 E DA+V++G+W+++ VG P F G + GKTLGIVG GRIG ALA+R GF M ++Y Sbjct: 119 ELDAWVKAGQWQRT-VG--PAEF-GVDIHGKTLGIVGLGRIGAALARRGHFGFRMPVLYS 174 Query: 180 SRTR---KPEAEEEIGAEYVDFETLLKESDFISLHVPLTKETYHMIGEKELKLMKPNAIL 236 +R KPE E E+GA ++ + LL ++DF+ L VPL ET ++IG +EL LMK +AIL Sbjct: 175 GNSRNSRKPELEAELGARFLPLDDLLAQADFVVLVVPLGPETRNLIGRRELALMKDSAIL 234 Query: 237 INTSRGAVVDTNALIKALKEGWIAGAGLDVFEEEPYYNEELFKLKNVVLAPHIGSATHEA 296 +N +RGAVVD ALI+AL+ I GAGLDV++ EP LF L VV PH+GSAT E Sbjct: 235 VNLARGAVVDEPALIEALQSRQIRGAGLDVYQTEPLAASPLFALPQVVTLPHLGSATEET 294 Query: 297 REGMAELVAKNLIAFAKGEIPPNLVNKDV 325 R+ MA N KGE P +LVN V Sbjct: 295 RDAMARRALDNFHQAMKGERPRDLVNPQV 323 Lambda K H 0.317 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 337 Length adjustment: 28 Effective length of query: 303 Effective length of database: 309 Effective search space: 93627 Effective search space used: 93627 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory