GapMind for catabolism of small carbon sources

 

Protein WP_008992176.1 in Galbibacter marinus ck-I2-15

Annotation: NCBI__GCF_000300875.1:WP_008992176.1

Length: 225 amino acids

Source: GCF_000300875.1 in NCBI

Candidate for 79 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-glutamate catabolism gltL med GluA aka CGL1950, component of Glutamate porter (characterized) 42% 88% 155.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-histidine catabolism aapP lo ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) 38% 84% 148.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-asparagine catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 38% 83% 146.4 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-aspartate catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 38% 83% 146.4 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 84% 145.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 84% 145.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 84% 145.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 84% 145.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 84% 145.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 36% 85% 140.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-histidine catabolism Ac3H11_2560 lo ABC transporter for L-Histidine, ATPase component (characterized) 37% 78% 138.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-asparagine catabolism aatP lo ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component (characterized) 39% 89% 136.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-aspartate catabolism aatP lo ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component (characterized) 39% 89% 136.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-lysine catabolism hisP lo Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) 37% 83% 136.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 61% 135.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-cellobiose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 38% 61% 135.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 61% 135.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 61% 135.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-glucose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 38% 61% 135.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 61% 135.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
lactose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 38% 61% 135.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 37% 59% 135.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 61% 135.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-maltose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 38% 61% 135.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 61% 135.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 61% 135.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
sucrose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 38% 61% 135.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 61% 135.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
trehalose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 38% 61% 135.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 39% 57% 135.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-histidine catabolism BPHYT_RS24015 lo ABC transporter related (characterized, see rationale) 34% 85% 133.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-arginine catabolism artP lo Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 35% 86% 132.9 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-histidine catabolism hisP lo Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 35% 86% 132.9 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-maltose catabolism thuK lo ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 35% 61% 132.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
sucrose catabolism thuK lo ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 35% 61% 132.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
trehalose catabolism thuK lo ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 35% 61% 132.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 39% 55% 131 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-glucosamine (chitosamine) catabolism AO353_21725 lo ABC transporter for D-Glucosamine, putative ATPase component (characterized) 36% 85% 130.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 37% 57% 129.4 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-mannose catabolism TM1750 lo TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 36% 69% 129 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 38% 58% 128.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-mannitol catabolism mtlK lo ABC transporter for D-Mannitol, D-Mannose, and D-Mannose, ATPase component (characterized) 33% 57% 127.9 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 35% 56% 124.4 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 35% 54% 124 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 34% 53% 123.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 35% 52% 122.9 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-proline catabolism proV lo glycine betaine/l-proline transport atp-binding protein prov (characterized) 32% 51% 122.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-maltose catabolism malK lo Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 33% 54% 121.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 36% 51% 120.9 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 33% 54% 119.8 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 35% 57% 119 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 36% 57% 119 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 56% 119 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 56% 119 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 56% 119 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-maltose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 56% 119 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 56% 119 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
sucrose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 56% 119 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 56% 119 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
trehalose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 56% 119 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 56% 119 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 35% 51% 116.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-tryptophan catabolism ecfA1 lo Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) 35% 78% 114.4 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
glycerol catabolism glpT lo GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) 34% 55% 111.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-mannose catabolism TM1749 lo TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 33% 72% 110.5 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 31% 55% 109.8 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 31% 55% 109.8 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-arabinose catabolism xylGsa lo Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale) 34% 78% 107.5 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-cellobiose catabolism cbtD lo CbtD, component of Cellobiose and cellooligosaccharide porter (characterized) 33% 66% 102.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-cellobiose catabolism TM0027 lo TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) 33% 78% 99.8 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
glycerol catabolism glpS lo GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized) 32% 53% 99 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
D-cellobiose catabolism TM0028 lo TM0028, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) 30% 71% 92.4 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-alanine catabolism braG lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 30% 77% 91.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-isoleucine catabolism natE lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 30% 77% 91.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-leucine catabolism natE lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 30% 77% 91.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-proline catabolism natE lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 30% 77% 91.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-serine catabolism braG lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 30% 77% 91.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-threonine catabolism braG lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 30% 77% 91.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8
L-valine catabolism natE lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 30% 77% 91.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 213.8

Sequence Analysis Tools

View WP_008992176.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MIKITDLEKYYRTEEVQTIALNKLSFEVKEGEFVAVMGPSGCGKSTLLNILGLLDDPDNG
SFIFNGIEVSGFNERKRANLRKHNIGFVFQSFNLIDELTVFENVELPLIYTGVKPSERKK
RVHEVLEKMQIMHRRKHFPQQLSGGQQQRVAVARAVVNNPKLILADEPTGNLDSSNGNEV
MDLLTALNEQGTTIVMVTHSEHDAKFSHRIIRMLDGEKVTENVLV

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory