Align Phosphoglucosamine/phosphogalactosamine mutase; PGlcNM; EC 5.4.2.10; EC 5.4.2.13 (characterized)
to candidate WP_017257344.1 B176_RS0103240 phosphoglucosamine mutase
Query= SwissProt::Q976E4 (455 letters) >NCBI__GCF_000302595.1:WP_017257344.1 Length = 459 Score = 209 bits (532), Expect = 2e-58 Identities = 148/457 (32%), Positives = 245/457 (53%), Gaps = 31/457 (6%) Query: 9 GVRGIVNKE----LTPELVLKLSKAIGTF-FGK--NSKILVGRDVRAGGDMLVKIVEGGL 61 G+RG + + LTP ++K + A G + F K N+KI++GRD R G+M+ +V G L Sbjct: 9 GIRGTIGGKAGYGLTPADIVKFTAAYGKWIFAKTGNNKIVLGRDARISGEMVRNLVVGTL 68 Query: 62 LSVGVEVYDGGMAPTPALQYAVKTLGYDGGVVITASHNPAPYNGIKVVDKDGIEIRREKE 121 S+G+ V D G++ TP ++ AV GG+++TASHNP +N +K++++ G I Sbjct: 69 QSIGLNVIDLGLSTTPTVEIAVPQEKAGGGIILTASHNPKEWNALKLLNEKGEFISDSDG 128 Query: 122 NEIEDLFFTERFNTIEWSSLTT--EVKREDRVISTYVNGILS--HVDIEKIKKKNYKVLI 177 E+ L + F I +S + +V +D + +++ +L+ VD+E IK N+K+ I Sbjct: 129 KEL--LEIADNFE-ISFSGVDDLGKVTYDDTYLQKHIDQVLALPLVDVEAIKNANFKIAI 185 Query: 178 DPANSVGALSTPLVARALGCK-IYTI----NGNLDPLFSARQPEPTFDSLKETAEVVKTL 232 D NS G + P + RALG + IY + NG+ PEP + L E + +V Sbjct: 186 DCVNSSGGIFIPALLRALGVETIYELFCEPNGHF-----PHNPEPLPEHLTEISAMVVKN 240 Query: 233 KVDLGVAHDGDADRAIFIDSEGRVQWGDRSGTLLSYWASVKNPKAIKKIVTAVSSSSLVE 292 K DLG+ D D DR F++ +G + + + ++ + P + V+ +SS+ + Sbjct: 241 KADLGIVVDPDVDRLCFVNEDGSMFGEEYTLVAVADYVLQHTPGS---TVSNLSSTRALR 297 Query: 293 EYLSKYNIQVDWTKVGSVDIAHKVADENALAGFEENGGFMYPPHQYVRDGAMSFALMLEL 352 + + + VG V++ + + +A+ G E NGG +YP Y RD + AL L Sbjct: 298 DVTENAGQKYQASAVGEVNVVNLMKSCDAVIGGEGNGGIIYPELHYGRDALVGVALFLTH 357 Query: 353 LANENVSSAELFDRLPKYYLVKTKVDLKPGLMVEEIYKKILEVYSTSSVKAITIDGVKI- 411 LA + ++L P Y++ K K+ L+ G+ V+ I KK+ Y + TIDG+KI Sbjct: 358 LAKSGKTISQLKASYPTYHISKNKITLEEGMDVDGILKKVEAKYRLQPLS--TIDGLKIE 415 Query: 412 IGKDFWFLVRKSGTEPIIRIMAEAKDENVANNLVNEL 448 GK+ W +RKS TEPIIRI +E+++E AN L ++ Sbjct: 416 FGKE-WVHLRKSNTEPIIRIYSESENEQKANKLAKQI 451 Lambda K H 0.316 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 482 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 455 Length of database: 459 Length adjustment: 33 Effective length of query: 422 Effective length of database: 426 Effective search space: 179772 Effective search space used: 179772 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory