GapMind for catabolism of small carbon sources

 

Protein WP_040659510.1 in Oscillibacter ruminantium GH1

Annotation: NCBI__GCF_000307265.1:WP_040659510.1

Length: 326 amino acids

Source: GCF_000307265.1 in NCBI

Candidate for 65 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
putrescine catabolism potA med Spermidine/putrescine import ATP-binding protein PotA, component of The spermidine/putrescine uptake porter, PotABCD (characterized) 42% 80% 238.8 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
trehalose catabolism treV med TreV, component of Trehalose porter (characterized) 45% 73% 223.4 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
D-maltose catabolism thuK med ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 40% 78% 211.1 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
sucrose catabolism thuK med ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 40% 78% 211.1 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
trehalose catabolism thuK med ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 40% 78% 211.1 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
D-maltose catabolism musK med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 40% 70% 209.9 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 39% 91% 231.1 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 39% 88% 225.3 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 39% 88% 225.3 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 40% 82% 219.2 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 43% 69% 217.2 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 41% 69% 216.9 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
D-mannitol catabolism mtlK lo SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 40% 80% 216.5 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 42% 67% 215.7 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
D-cellobiose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 40% 66% 214.5 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
D-glucose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 40% 66% 214.5 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
lactose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 40% 66% 214.5 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
D-maltose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 40% 66% 214.5 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 40% 66% 214.5 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
sucrose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 40% 66% 214.5 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
trehalose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 40% 66% 214.5 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 40% 80% 214.5 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
D-maltose catabolism malK lo ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized) 41% 68% 211.8 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 41% 69% 211.1 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 41% 69% 211.1 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 41% 69% 211.1 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 38% 76% 210.3 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 43% 59% 210.3 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 88% 209.1 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 88% 209.1 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 88% 209.1 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 88% 209.1 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 88% 209.1 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 88% 209.1 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 41% 63% 208 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 38% 76% 208 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 42% 59% 206.5 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 35% 92% 206.1 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 39% 68% 204.9 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
trehalose catabolism malK lo MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized) 39% 69% 204.5 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 37% 80% 201.8 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 39% 67% 201.4 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 40% 67% 189.1 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 40% 67% 189.1 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 40% 67% 189.1 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 40% 67% 189.1 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
L-proline catabolism opuBA lo BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) 41% 60% 184.5 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
L-histidine catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 37% 86% 166 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 37% 86% 166 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
glycerol catabolism glpS lo ABC transporter for Glycerol, ATPase component 1 (characterized) 36% 72% 151.8 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
L-histidine catabolism Ac3H11_2560 lo ABC transporter for L-Histidine, ATPase component (characterized) 39% 84% 148.7 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
L-isoleucine catabolism livF lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 36% 97% 129.8 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
L-leucine catabolism livF lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 36% 97% 129.8 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
L-valine catabolism livF lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 36% 97% 129.8 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
citrate catabolism fecE lo iron(III) dicitrate transport ATP-binding protein FecE (characterized) 30% 87% 119.4 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
L-phenylalanine catabolism livF lo high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized) 32% 97% 117.5 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
L-alanine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 97% 114.8 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
L-serine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 97% 114.8 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
L-threonine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 97% 114.8 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
L-arginine catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 31% 91% 114.4 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
L-glutamate catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 31% 91% 114.4 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
L-histidine catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 31% 91% 114.4 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
L-histidine catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 87% 105.5 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
L-leucine catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 87% 105.5 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3
L-proline catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 87% 105.5 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 252.3

Sequence Analysis Tools

View WP_040659510.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MNEIELNGITSHYGQTRVLDDVSFRIAQGELHTLLGPSGCGKTTLLRLLGGFLQPTAGRI
FLDGREITSLPPEKRNMGIVFQNYALFPHLNVEENVAYGLKLHRINAAQVRETVRAQLDL
MGLWECRTRKIQELSGGQQQRVAIARALAASPRILLLDEPMSNLDVSLRIKMRQELRQIQ
QKVGVTTLFITHDQQEALAISDTMSVMHDGRIEQTGSPREIYESPKTSFVATFVGKTNML
DRAAMTALGGHGEAETSYLRPEQLVLEPVKTAQTPLPGQVIRVHYQGAMVEYEVKTDAGI
LCVLALNNHRGNGPVVGGAVFAGLRP

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory