Align Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized)
to candidate WP_040659206.1 ON16_RS02840 ABC transporter permease
Query= TCDB::G4FGN4 (313 letters) >NCBI__GCF_000307265.1:WP_040659206.1 Length = 320 Score = 169 bits (429), Expect = 6e-47 Identities = 95/295 (32%), Positives = 155/295 (52%), Gaps = 2/295 (0%) Query: 16 ILIAIVVFLGVTTREFLTVENIFTVILNVSFIAIMSFGMTMVIITSGIDLSVGSILGAAS 75 +L+ ++ F + F T+ N + +S + ++S G T+V+ DLSVG + Sbjct: 23 LLVIVLAFSAIRPSSFCTLTNFINITRQMSLLVVISLGATVVMSVGEFDLSVGQMASLGG 82 Query: 76 VVMGLLMDEKGLSPFLSVVIGLAVGVGFGLANGLLITKARLAPFISTLGMLSVGRGLAYV 135 V L G+ L + L GL NG ++ + R FI+TLGM +V G+ Y Sbjct: 83 VAAAQLA-VAGVPLALCFTLPLLAAAAVGLVNGWVVARFRALSFITTLGMSTVLSGVVYR 141 Query: 136 MSGGWPI-SPFPESFTVHGQGMVGPVPVPVIYMAVIGVIAHIFLKYTVTGRRIYAIGGNM 194 +SGG + P+ F+V G +G +P+ I M ++ +++T TGR+ YAIGG Sbjct: 142 LSGGATVFENIPKGFSVLGTAKLGRIPLLSILMLGFVLLLWFLMRHTPTGRKFYAIGGGE 201 Query: 195 EASKLVGIKTDRILILVYTINGFLAAFAGFLLTAWLGVAQPNAGQGYELDVIAATVIGGT 254 EA+++ GI R +L + + +A AG L+ + +G A AG GY L AA IG T Sbjct: 202 EAARVAGIPVKRCKLLAFVLCAVMACVAGMLIASRVGSANTTAGDGYFLKSYAAVFIGCT 261 Query: 255 SLSGGEGTILGAFLGAVIMGVLRNGMILLGVSSFWQQVVIGIVIIIAIAIDQIRR 309 + G +LG LGA I+GVL NG+ +L + ++ Q ++ G +II+A+ ++ R Sbjct: 262 ASRRGVPNVLGTLLGAAILGVLANGLTMLQMPTYMQDIITGAIIILAVVAQRLGR 316 Lambda K H 0.328 0.145 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 320 Length adjustment: 27 Effective length of query: 286 Effective length of database: 293 Effective search space: 83798 Effective search space used: 83798 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory