Align Fructose import permease protein FrcC (characterized)
to candidate WP_040662387.1 ON16_RS11050 ABC transporter permease
Query= SwissProt::Q9F9B1 (360 letters) >NCBI__GCF_000307265.1:WP_040662387.1 Length = 332 Score = 154 bits (389), Expect = 3e-42 Identities = 98/306 (32%), Positives = 161/306 (52%), Gaps = 7/306 (2%) Query: 48 AAVPLIVLVLSLIAFGVILGGKFFSAFTMTLILQQVAIVGIVGAAQTLVILTAGIDLSVG 107 + V ++ L L + F S + +L+Q+A I+G Q V++T IDLS+G Sbjct: 20 SVVTAVIGFLILFVVFAVASPSFRSGNNIQNLLRQIAPTLIIGIGQGYVLITGNIDLSIG 79 Query: 108 AIMVLSSVIMGQFTFRYGFPPALSVICGLGVGALCGYINGTLVARMKLPPFIVTLGMWQI 167 +++ +S + G + G P L+ + + + L G++NGTLVA+MKLP FI TLG + Sbjct: 80 SVVGMSCMTAGTMMTK-GVNPVLACLLTVLLALLVGFVNGTLVAKMKLPSFIATLGT--M 136 Query: 168 VLASNFLYSANETIRAQDISANASILQFFGQNFRIGNAVFTYGVV-VMVLLVCLLWYVLN 226 LA N I +A Q F F G Y V + V+L + ++L+ Sbjct: 137 TLARGLAQLVNNNHNTDFIGNDA---QAFRDLFYYGEFAKLYSAVWIAVILWVVFNFLLS 193 Query: 227 RTAWGRYVYAVGDDPEAAKLAGVNVTRMLISIYTLSGLICALAGWALIGRIGSVSPTAGQ 286 +T GR++YAVG + +AA+L+G+N R ++ Y +S + G L+ G + AG Sbjct: 194 KTRTGRHIYAVGSNLDAARLSGINEYRTILITYVVSAFCACVTGLILLASAGMGTMDAGG 253 Query: 287 FANIESITAVVIGGISLFGGRGSIMGMLFGALIVGVFSLGLRLMGTDPQWTYLLIGLLII 346 + ++ A VIGGIS GG G + G++ GA I G+ GL+ +G ++IG+++I Sbjct: 254 TYEMYAVAACVIGGISTLGGTGILAGVIAGAGIWGILQNGLQFVGAPVALRNIIIGIIVI 313 Query: 347 IAVAID 352 +AV +D Sbjct: 314 LAVMMD 319 Lambda K H 0.327 0.141 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 328 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 332 Length adjustment: 29 Effective length of query: 331 Effective length of database: 303 Effective search space: 100293 Effective search space used: 100293 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory