Align Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 (characterized)
to candidate WP_040660027.1 ON16_RS04985 acetyl-CoA C-acetyltransferase
Query= SwissProt::P14611 (393 letters) >NCBI__GCF_000307265.1:WP_040660027.1 Length = 418 Score = 451 bits (1159), Expect = e-131 Identities = 234/418 (55%), Positives = 299/418 (71%), Gaps = 27/418 (6%) Query: 1 MTDVVIVSAARTAVGKFGGSLAKIPAPELGAVVIKAALERAGVKPEQVSEVIMGQVLTAG 60 M ++ +V+ RTA+G FGG+L PA ELG++V+K AL RAGVKPEQV EV+ G +LTAG Sbjct: 1 MKELYVVNCCRTAIGSFGGTLKNTPATELGSIVVKEALNRAGVKPEQVDEVMFGCILTAG 60 Query: 61 SGQNPARQAAIKAGLPAMVPAMTINKVCGSGLKAVMLAANAIMAGDAEIVVAGGQENMSA 120 GQN ARQ A+KAG+P VPA T+ VCGSG+K+V+ A +I+AGDA+++V GG ENMSA Sbjct: 61 LGQNVARQVAVKAGIPYSVPAYTVGMVCGSGMKSVIEGARSILAGDADVIVCGGTENMSA 120 Query: 121 APHVLPGSRDGFRMGDAKLVDTMIVDGLWDVYNQYHMGITAENVAKEYGITREAQDEFAV 180 AP+ P +R G RMGD KLVDTMI DGLWD +N YHMG TAEN+ +GITR+ DEFAV Sbjct: 121 APYAAPDARWGARMGDKKLVDTMIKDGLWDAFNNYHMGTTAENICDVWGITRQELDEFAV 180 Query: 181 GSQNKAEAAQKAGKFDEEIVPVLIPQRKGDPVAFKTDEFVRQGATLDSMSGLKPAF---- 236 SQ K EAAQ AGKFD+EIV V + +K D V FK DEF R G TL+ + +K AF Sbjct: 181 SSQQKCEAAQAAGKFDDEIVAVPVKVKK-DIVEFKKDEFPRAGTTLEGVGKMKGAFPVGP 239 Query: 237 -------------------DKAGT--VTAANASGLNDGAAAVVVMSAAKAKELGLTPLAT 275 D GT VTAA++SG+NDGAAA+V+ S + GL P+A Sbjct: 240 ESPNPQVVHTFEVTGAKETDDKGTQRVTAASSSGINDGAAAIVLASGEAVAKYGLKPMAK 299 Query: 276 IKSYANAGVDPKVMGMGPVPASKRALSRAEWTPQDLDLMEINEAFAAQALAVHQQMGWDT 335 + + GVDPK+MG+GPVPAS++A+ +A T D+DL+E NEAFAAQ++AV +++ +D Sbjct: 300 LIGWGQGGVDPKIMGVGPVPASQQAMKKAGVTIDDMDLVEANEAFAAQSIAVARELHFDM 359 Query: 336 SKVNVNGGAIAIGHPIGASGCRILVTLLHEM-KRRDAKKGLASLCIGGGMGVALAVER 392 SKVNVNGGA+++GHP+G SG RI+VTLLHE+ KR DAKKGLA+LCIGGG GVA E+ Sbjct: 360 SKVNVNGGALSLGHPVGCSGARIIVTLLHELQKRDDAKKGLATLCIGGGQGVATIFEK 417 Lambda K H 0.315 0.131 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 459 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 418 Length adjustment: 31 Effective length of query: 362 Effective length of database: 387 Effective search space: 140094 Effective search space used: 140094 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory