Align ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family; SubName: Full=Sugar ABC transporter permease (characterized, see rationale)
to candidate WP_040659206.1 ON16_RS02840 ABC transporter permease
Query= uniprot:A0A1N7UKA9 (325 letters) >NCBI__GCF_000307265.1:WP_040659206.1 Length = 320 Score = 184 bits (467), Expect = 3e-51 Identities = 101/288 (35%), Positives = 172/288 (59%), Gaps = 4/288 (1%) Query: 33 LLCVVMAFSS---EYFMTWRNWMDILRQTSINGILAVGMTYVILTKGIDLSVGSILAFAG 89 LL +V+AFS+ F T N+++I RQ S+ ++++G T V+ DLSVG + + G Sbjct: 23 LLVIVLAFSAIRPSSFCTLTNFINITRQMSLLVVISLGATVVMSVGEFDLSVGQMASLGG 82 Query: 90 LCSAMVATQGYGLLAAVSAGMFAGAMLGVVNGFMVANLSIPPFVATLGMLSIARGMTFIL 149 + +A +A G L + + A A +G+VNG++VA F+ TLGM ++ G+ + L Sbjct: 83 VAAAQLAVAGVPLALCFTLPLLAAAAVGLVNGWVVARFRALSFITTLGMSTVLSGVVYRL 142 Query: 150 NDGSPITD-LPDAYLALGIGKIGPIGVPIIIFAVVALIFWMVLRYTTYGRYVYAVGGNEK 208 + G+ + + +P + LG K+G I + I+ L+ W ++R+T GR YA+GG E+ Sbjct: 143 SGGATVFENIPKGFSVLGTAKLGRIPLLSILMLGFVLLLWFLMRHTPTGRKFYAIGGGEE 202 Query: 209 SARTSGIGVRKVMFSVYVVSGLLAGLAGVVLSARTTSALPQAGVSYELDAIAAVVIGGTS 268 +AR +GI V++ +V+ ++A +AG+++++R SA AG Y L + AAV IG T+ Sbjct: 203 AARVAGIPVKRCKLLAFVLCAVMACVAGMLIASRVGSANTTAGDGYFLKSYAAVFIGCTA 262 Query: 269 LSGGTGSIVGTLFGALLIGVINNGLNLLGVSSYYQQVAKGLIIVFAVL 316 G +++GTL GA ++GV+ NGL +L + +Y Q + G II+ AV+ Sbjct: 263 SRRGVPNVLGTLLGAAILGVLANGLTMLQMPTYMQDIITGAIIILAVV 310 Lambda K H 0.326 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 320 Length adjustment: 28 Effective length of query: 297 Effective length of database: 292 Effective search space: 86724 Effective search space used: 86724 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory