Align ABC-type transporter, integral membrane subunit, component of Xylose porter (Nanavati et al. 2006). Regulated by xylose-responsive regulator XylR (characterized)
to candidate WP_040659206.1 ON16_RS02840 ABC transporter permease
Query= TCDB::Q9WXW7 (317 letters) >NCBI__GCF_000307265.1:WP_040659206.1 Length = 320 Score = 157 bits (396), Expect = 4e-43 Identities = 96/295 (32%), Positives = 159/295 (53%), Gaps = 3/295 (1%) Query: 19 LVSLAVFTAILNPRFLTAFNLQALGRQIAIFGLLAIGETFVIISGGGAIDLSPGSMVALT 78 LV + F+AI F T N + RQ+++ ++++G T ++ G DLS G M +L Sbjct: 24 LVIVLAFSAIRPSSFCTLTNFINITRQMSLLVVISLGAT--VVMSVGEFDLSVGQMASLG 81 Query: 79 GVMVAWLMTHGVPVWISVILILLFSIGAGAWHGLFVTKLRVPAFIITLGTLTIARGMAAV 138 GV A L GVP+ + L LL + G +G V + R +FI TLG T+ G+ Sbjct: 82 GVAAAQLAVAGVPLALCFTLPLLAAAAVGLVNGWVVARFRALSFITTLGMSTVLSGVVYR 141 Query: 139 ITKGWPII-GLPSSFLKIGQGEFLKIPIPVWILLAVALVADFFLRKTVYGKHLRASGGNE 197 ++ G + +P F +G + +IP+ ++L L+ F +R T G+ A GG E Sbjct: 142 LSGGATVFENIPKGFSVLGTAKLGRIPLLSILMLGFVLLLWFLMRHTPTGRKFYAIGGGE 201 Query: 198 VAARFSGVNVDRVRMIAFMVSGFLAGVVGIIIAARLSQGQPGVGSMYELYAIASTVIGGT 257 AAR +G+ V R +++AF++ +A V G++IA+R+ G Y L + A+ IG T Sbjct: 202 EAARVAGIPVKRCKLLAFVLCAVMACVAGMLIASRVGSANTTAGDGYFLKSYAAVFIGCT 261 Query: 258 SLTGGEGSVLGAIVGASIISLLWNALVLLNVSTYWHNVVIGIVIVVAVTLDILRR 312 + G +VLG ++GA+I+ +L N L +L + TY +++ G +I++AV L R Sbjct: 262 ASRRGVPNVLGTLLGAAILGVLANGLTMLQMPTYMQDIITGAIIILAVVAQRLGR 316 Lambda K H 0.328 0.143 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 285 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 320 Length adjustment: 27 Effective length of query: 290 Effective length of database: 293 Effective search space: 84970 Effective search space used: 84970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory