GapMind for catabolism of small carbon sources

 

Protein WP_040388610.1 in Catellicoccus marimammalium M35/04/3

Annotation: NCBI__GCF_000313915.1:WP_040388610.1

Length: 227 amino acids

Source: GCF_000313915.1 in NCBI

Candidate for 32 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-asparagine catabolism aatP lo PP1068, component of Acidic amino acid uptake porter, AatJMQP (characterized) 39% 85% 157.9 Cell division ATP-binding protein FtsE 61% 302.0
L-aspartate catabolism aatP lo PP1068, component of Acidic amino acid uptake porter, AatJMQP (characterized) 39% 85% 157.9 Cell division ATP-binding protein FtsE 61% 302.0
L-glutamate catabolism gltL lo PP1068, component of Acidic amino acid uptake porter, AatJMQP (characterized) 39% 85% 157.9 Cell division ATP-binding protein FtsE 61% 302.0
L-asparagine catabolism glnQ lo Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 36% 88% 153.7 Cell division ATP-binding protein FtsE 61% 302.0
L-arginine catabolism artP lo ABC transporter for L-Arginine, putative ATPase component (characterized) 36% 87% 153.3 Cell division ATP-binding protein FtsE 61% 302.0
L-asparagine catabolism bgtA lo ATPase (characterized, see rationale) 36% 84% 152.1 Cell division ATP-binding protein FtsE 61% 302.0
L-aspartate catabolism bgtA lo ATPase (characterized, see rationale) 36% 84% 152.1 Cell division ATP-binding protein FtsE 61% 302.0
L-histidine catabolism PA5503 lo Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 36% 67% 148.7 Cell division ATP-binding protein FtsE 61% 302.0
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 37% 85% 147.9 Cell division ATP-binding protein FtsE 61% 302.0
L-histidine catabolism aapP lo ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) 38% 84% 146.4 Cell division ATP-binding protein FtsE 61% 302.0
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 87% 144.8 Cell division ATP-binding protein FtsE 61% 302.0
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 87% 144.8 Cell division ATP-binding protein FtsE 61% 302.0
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 87% 144.8 Cell division ATP-binding protein FtsE 61% 302.0
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 87% 144.8 Cell division ATP-binding protein FtsE 61% 302.0
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 87% 144.8 Cell division ATP-binding protein FtsE 61% 302.0
L-histidine catabolism bgtA lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 36% 87% 144.1 Cell division ATP-binding protein FtsE 61% 302.0
L-histidine catabolism hisP lo Histidine transport ATP-binding protein HisP (characterized) 34% 89% 144.1 Cell division ATP-binding protein FtsE 61% 302.0
L-lysine catabolism hisP lo Histidine transport ATP-binding protein HisP (characterized) 34% 89% 144.1 Cell division ATP-binding protein FtsE 61% 302.0
L-citrulline catabolism AO353_03040 lo ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) 32% 88% 143.7 Cell division ATP-binding protein FtsE 61% 302.0
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 35% 52% 137.5 Cell division ATP-binding protein FtsE 61% 302.0
putrescine catabolism potA lo spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) 34% 56% 136 Cell division ATP-binding protein FtsE 61% 302.0
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 34% 58% 135.2 Cell division ATP-binding protein FtsE 61% 302.0
D-maltose catabolism thuK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 34% 58% 135.2 Cell division ATP-binding protein FtsE 61% 302.0
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 34% 58% 135.2 Cell division ATP-binding protein FtsE 61% 302.0
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 34% 58% 135.2 Cell division ATP-binding protein FtsE 61% 302.0
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 34% 61% 132.1 Cell division ATP-binding protein FtsE 61% 302.0
L-alanine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 32% 95% 114.4 Cell division ATP-binding protein FtsE 61% 302.0
L-isoleucine catabolism livF lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 32% 95% 114.4 Cell division ATP-binding protein FtsE 61% 302.0
L-leucine catabolism livF lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 32% 95% 114.4 Cell division ATP-binding protein FtsE 61% 302.0
L-serine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 32% 95% 114.4 Cell division ATP-binding protein FtsE 61% 302.0
L-threonine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 32% 95% 114.4 Cell division ATP-binding protein FtsE 61% 302.0
L-valine catabolism livF lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 32% 95% 114.4 Cell division ATP-binding protein FtsE 61% 302.0

Sequence Analysis Tools

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MIQMRDVSKKYKNGTTALRNVSVSVEPGEFIYVVGPSGSGKSTFLKLIYREEKANRGEIV
VAGENLMKLKNKKVPFLRRKMGTIFQDYKLLPNKTAYENIAYAMQVIGKKPYEIKKRVQE
VLDLVGLRHKAKMFPNQLSGGEQQRIAIARAIVNTPKILIADEPTGNLDPENTWEIMKIL
ERINQQGTTVIMGTHNSSIVNTIRHRVLTIENGRIVHDEMEGVYTYD

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory