Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate WP_009491712.1 C683_RS05310 amino acid ABC transporter ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_03040 (254 letters) >NCBI__GCF_000313915.1:WP_009491712.1 Length = 244 Score = 254 bits (649), Expect = 1e-72 Identities = 130/254 (51%), Positives = 184/254 (72%), Gaps = 15/254 (5%) Query: 3 KLEVQDLHKRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILL 62 K++ +++HK+Y + VLKG+ L G+V+ +IG SGSGKSTFLRC+N LE+P +G + + Sbjct: 4 KIQAKEIHKKYKKNHVLKGIDLTIHQGEVVVLIGPSGSGKSTFLRCLNYLEEPTSGTVSI 63 Query: 63 NNEELKLVANKDGALKAADPKQLQRMRSRLSMVFQHFNLWSHMTAMENIMEAP--VHVLG 120 + E+L A+ K+L +R ++ MVFQHF+L+ HMT ENI AP + VL Sbjct: 64 DGEQL------------AEDKKLNNLRKKVGMVFQHFHLFEHMTVGENIAFAPRLLRVL- 110 Query: 121 MSKAEAREKAELYLAKVGVSHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSAL 180 +K + + E LA+VG+S +K+A P +SGG++QRVAIAR+LAM PEV+LFDEPTSAL Sbjct: 111 KTKEDINTRVEDLLAQVGLSEKKEAMPHQLSGGQKQRVAIARSLAMNPEVILFDEPTSAL 170 Query: 181 DPELVGDVLKVMQALAQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVLVNP 240 DPE+VGDVL VM+ LA+EG TMV+VTHEMGFAR+V++++VF+ +GV+ E G P E+ P Sbjct: 171 DPEMVGDVLDVMKQLAKEGMTMVIVTHEMGFARQVADRVVFMAEGVIVEEGTPSEIFDTP 230 Query: 241 QSERLQQFLSGSLK 254 + ER +QFL+ LK Sbjct: 231 KEERTKQFLAKVLK 244 Lambda K H 0.317 0.131 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 244 Length adjustment: 24 Effective length of query: 230 Effective length of database: 220 Effective search space: 50600 Effective search space used: 50600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory