Align acetyl-CoA C-acetyltransferase [EC: 2.3.1.9] (characterized)
to candidate WP_009488522.1 C683_RS01265 thiolase family protein
Query= reanno::pseudo5_N2C3_1:AO356_21640 (393 letters) >NCBI__GCF_000313915.1:WP_009488522.1 Length = 376 Score = 309 bits (792), Expect = 7e-89 Identities = 173/390 (44%), Positives = 239/390 (61%), Gaps = 17/390 (4%) Query: 3 EVVIVAATRTAIGSFQGSLAAIPAPELGAAVIRRLLEQTGLSGEQVDEVILGQVLTAGSG 62 ++ IV RT F G + E+ AA ++ LL++ + D+VILG+V AG G Sbjct: 2 KIAIVGMNRTPFAKFNGGFKDLAPNEIAAAAVKGLLDKEPKLKDLCDKVILGEVFGAGVG 61 Query: 63 QNPARQASILAGLPHAVPALTLNKVCGSGLKALHLGAQAIRCGDAEVIIAGGMENMSLAP 122 QNPAR A+I AGL V A+T+N+VCGSGL +L L AQ + G A+ IIAGG+++ + P Sbjct: 62 QNPARFAAIKAGLSEKVTAMTVNQVCGSGLLSLDLAAQMLETGRAQCIIAGGVDSFTKTP 121 Query: 123 YVLPAARTGLRMGHAKMIDSMITDGLWDAFNDYHMGITAENLVDKYGISREEQDAFAAAS 182 L+ + I DGL D F+ MG+TAEN+ + I+REEQDAFA S Sbjct: 122 L--------LKDRFTEEITDSFDDGLADDFSHEKMGVTAENVARAFHITREEQDAFAYQS 173 Query: 183 QQKAVAAIEGGRFADEITPILIPQRKGDPVAFATDEQPRAGTTAESLGKLKPAFKKDGSV 242 QQKA AA + G+FA ITP+ DE R T+ E L LK F +DG+V Sbjct: 174 QQKAKAAQDAGKFAQVITPV---------AGIEADECLRPTTSLEKLATLKTVFAEDGTV 224 Query: 243 TAGNASSLNDGAAAVILMSAEKAKALGLPVLAKISAYANAGVDPAIMGIGPVSATRRCLD 302 TAGN+S+L+DGAA V LM+ EKAKA GLP+LA I + G+DP MG+ P+ A + Sbjct: 225 TAGNSSALSDGAAVVALMTEEKAKAEGLPILATIQNFVEVGMDPEYMGVAPILAIQMLCQ 284 Query: 303 KAGWSLEQLDLIEANEAFAAQSLAVARELKWDMDKVNVNGGAIALGHPIGASGCRVLVSL 362 K +++ D IE NEAFA+QS+A +EL +K+N+ GGAIALGHP+GASG R+++ + Sbjct: 285 KEHRTIDDYDYIELNEAFASQSVACQKELNIPKEKLNIWGGAIALGHPLGASGTRLVMQM 344 Query: 363 LHEMIKRDAKKGLATLCIGGGQGVALALER 392 + ++ + D GL +LCIGGG G+AL + R Sbjct: 345 VQQLEENDKHLGLVSLCIGGGMGMALEVVR 374 Lambda K H 0.317 0.133 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 373 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 376 Length adjustment: 30 Effective length of query: 363 Effective length of database: 346 Effective search space: 125598 Effective search space used: 125598 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory