Align histidine permease (characterized)
to candidate WP_009490181.1 C683_RS03825 amino acid permease
Query= reanno::pseudo3_N2E3:AO353_12275 (468 letters) >NCBI__GCF_000313915.1:WP_009490181.1 Length = 448 Score = 365 bits (938), Expect = e-105 Identities = 181/438 (41%), Positives = 284/438 (64%), Gaps = 2/438 (0%) Query: 8 LKRGLSARHIRFMALGSAIGTGLFYGSASAIQMAGPAVLLAYLIGGAAVFMVMRALGEMA 67 L+RGLS RH++ +++G AIGTGLF S +I +AGP+VLLAY+I G VF +MR+LGE+ Sbjct: 6 LERGLSNRHVQLISIGGAIGTGLFLASGKSIAIAGPSVLLAYMIVGMFVFFIMRSLGELL 65 Query: 68 VHNPVAGSFGQYASTYLGPMAGFILGWTYAFEMVIVGMADVTAFGIYMGFWFPEVSRWIW 127 + N SF + A YLG F+ GWTY F + V M+D+TA G+YM +WFP + +WI Sbjct: 66 LANLDCHSFVELAHQYLGRRWAFVTGWTYWFCWITVAMSDLTAVGMYMRYWFPHLPQWIP 125 Query: 128 VLGVVSIVGGLNLCNVKVFGEMEFWLSLLKVAAIVAMILGGFGIMLFGISTAPGQVTDIS 187 L ++ + LNL +VK+FGE+EFWL+L+K+ AIVA+I G ++ G V + Sbjct: 126 ALLMLLFLMALNLLSVKLFGEIEFWLALIKILAIVALIGVGLYMIFTHHKLENGIVASFA 185 Query: 188 NLWTQGGFMPNGMGGLIASFAVVMFAFGGIEIIGVTAGEAKDPQHVLPRAINAVPLRILL 247 NL+ GGF P+G G I SF + +F+F G+E++G+TAGE +DP+ LP+AIN +P+RILL Sbjct: 186 NLYQDGGFFPHGFSGFILSFQLAVFSFTGVELVGLTAGETQDPEKTLPKAINNIPVRILL 245 Query: 248 FYVLTMLVLMSIFPWQQIGSQGSPFVQIFDKLGISSAATILNIVVITAAISAINSDIFGA 307 FYV ++ V+M++ PW I SPFV +F +GI++AA+I+N VV+++A SA NS +F Sbjct: 246 FYVGSLAVIMAVQPWNIIDPTQSPFVTVFSSIGIAAAASIINFVVLSSAASACNSALFST 305 Query: 308 GRMMFGLAQQGHAPKGFAHLSRNGVPWMTVVVMSVALLLGVLLNYLIPENVFLLIASIAT 367 RM++GLA+ +APK FA L++N P M +++ SV + + ++LNY++PE VF LI+ I+T Sbjct: 306 SRMLYGLAKDDNAPKTFAKLNKNSTPAMALLMSSVVVGITIVLNYVMPEGVFSLISGIST 365 Query: 368 FATVWVWLMILFTQVAMRRSMTAEQVAQLKFPVPFWPYAPMAAIAFMLFVFGVLGYFPDT 427 +++W +I+ + + E + KF + + ++ F+ + + T Sbjct: 366 VCFLFIWTIIVICHMKFLKQTKDED--RPKFRLKGAKVINILSLIFLALIIVICAVLEST 423 Query: 428 QAALIVGVVWIVLLVLAY 445 + AL + +W + L++ Y Sbjct: 424 RIALFITPIWFIALLIIY 441 Lambda K H 0.329 0.142 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 541 Number of extensions: 24 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 468 Length of database: 448 Length adjustment: 33 Effective length of query: 435 Effective length of database: 415 Effective search space: 180525 Effective search space used: 180525 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory