Align Aromatic amino acid transport protein AroP (characterized, see rationale)
to candidate WP_009490181.1 C683_RS03825 amino acid permease
Query= uniprot:A0A0C4YP23 (465 letters) >NCBI__GCF_000313915.1:WP_009490181.1 Length = 448 Score = 390 bits (1001), Expect = e-113 Identities = 191/444 (43%), Positives = 289/444 (65%), Gaps = 4/444 (0%) Query: 13 LKRGLKNRHIQLIALGGAIGTGLFLGIAQTIKMAGPSVLLGYAVAGIIAFFIMRQLGEMV 72 L+RGL NRH+QLI++GGAIGTGLFL ++I +AGPSVLL Y + G+ FFIMR LGE++ Sbjct: 6 LERGLSNRHVQLISIGGAIGTGLFLASGKSIAIAGPSVLLAYMIVGMFVFFIMRSLGELL 65 Query: 73 VDEPVAGSFSHFANKYCGSFAGFMSGWNYWVLYILVSMAELSAVGIYVQYWWPHIPTWAS 132 + SF A++Y G F++GW YW +I V+M++L+AVG+Y++YW+PH+P W Sbjct: 66 LANLDCHSFVELAHQYLGRRWAFVTGWTYWFCWITVAMSDLTAVGMYMRYWFPHLPQWIP 125 Query: 133 ALGFFLLINAINLTSVKSFGEMEFWFSIVKVLAIVGMIVFGGYLLASGTA---GPQASVS 189 AL L + A+NL SVK FGE+EFW +++K+LAIV +I G Y++ + G AS + Sbjct: 126 ALLMLLFLMALNLLSVKLFGEIEFWLALIKILAIVALIGVGLYMIFTHHKLENGIVASFA 185 Query: 190 NLWQHGGFFPNGISGLVMAMAVIMFSFGGLELVGITAAEADEPEKTIPKATNQVIYRILI 249 NL+Q GGFFP+G SG +++ + +FSF G+ELVG+TA E +PEKT+PKA N + RIL+ Sbjct: 186 NLYQDGGFFPHGFSGFILSFQLAVFSFTGVELVGLTAGETQDPEKTLPKAINNIPVRILL 245 Query: 250 FYVGALGVLLSLYPWEKVVTGGSPFVLIFHAMNSDIVATVLNAVVLTAALSVYNSGVYCN 309 FYVG+L V++++ PW + SPFV +F ++ A+++N VVL++A S NS ++ Sbjct: 246 FYVGSLAVIMAVQPWNIIDPTQSPFVTVFSSIGIAAAASIINFVVLSSAASACNSALFST 305 Query: 310 SRMLFGLAKQGNAPKALLKVNKRGIPLAALGVSALATAACVVINYFMPGEAFELLMGLVV 369 SRML+GLAK NAPK K+NK P AL +S++ +V+NY MP F L+ G+ Sbjct: 306 SRMLYGLAKDDNAPKTFAKLNKNSTPAMALLMSSVVVGITIVLNYVMPEGVFSLISGIST 365 Query: 370 SALIINWAMISIIHLKFRRDKRAAGQETRFKSLGYPLTNYVCLAFLAGILYVMYLTPGLR 429 + W +I I H+KF + + +F+ G + N + L FLA I+ + + R Sbjct: 366 VCFLFIWTIIVICHMKFLKQTKDE-DRPKFRLKGAKVINILSLIFLALIIVICAVLESTR 424 Query: 430 ISVYLIPAWLAVLGLSYRLRQKQK 453 I++++ P W L + Y+++ K++ Sbjct: 425 IALFITPIWFIALLIIYQVKFKEQ 448 Lambda K H 0.326 0.140 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 530 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 465 Length of database: 448 Length adjustment: 33 Effective length of query: 432 Effective length of database: 415 Effective search space: 179280 Effective search space used: 179280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory