Align Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized)
to candidate WP_009488382.1 C683_RS00885 ABC transporter ATP-binding protein
Query= SwissProt::P17328 (400 letters) >NCBI__GCF_000313915.1:WP_009488382.1 Length = 362 Score = 178 bits (451), Expect = 3e-49 Identities = 94/243 (38%), Positives = 147/243 (60%), Gaps = 15/243 (6%) Query: 22 FKYIEKGLSKEQILEKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPT 81 F +++K + IL+ D + +IEEG+ + ++G SG GK+T++RL+ E T Sbjct: 7 FDHVKKSYGENTILQ---------DITFSIEEGKFYTLLGPSGCGKTTILRLMAGFTEVT 57 Query: 82 RGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGIAAQER 141 G + ++G I + ++ I VFQ +AL PHM V +N AFG+++ + +E Sbjct: 58 EGNIYLNGEKINNLP------ANKRPINTVFQDYALFPHMNVYENIAFGLQIKKVPKEEI 111 Query: 142 REKALDALRQVGLENYAHAYPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRT 201 +++ +AL+ V L + + DE+SGG RQRV +ARA+ P +LL+DEA SALD +RT Sbjct: 112 KQRVSEALQLVQLSGFENRSIDEMSGGQRQRVAIARAIVNKPKVLLLDEALSALDQNLRT 171 Query: 202 EMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYV 261 +MQ EL +LQ K T VF++HD +EA+ + D I IM G++VQ GTP +I + P N +V Sbjct: 172 QMQGELRQLQKKLGITFVFVTHDQEEALAMSDEIFIMNEGKIVQSGTPVDIYDEPINRFV 231 Query: 262 RTF 264 F Sbjct: 232 ANF 234 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 317 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 362 Length adjustment: 30 Effective length of query: 370 Effective length of database: 332 Effective search space: 122840 Effective search space used: 122840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory