Align glycine betaine/l-proline transport atp-binding protein prov (characterized)
to candidate WP_009488954.1 C683_RS02320 ABC transporter ATP-binding protein
Query= CharProtDB::CH_001555 (400 letters) >NCBI__GCF_000313915.1:WP_009488954.1 Length = 312 Score = 167 bits (423), Expect = 4e-46 Identities = 94/231 (40%), Positives = 144/231 (62%), Gaps = 8/231 (3%) Query: 44 VKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREV 103 ++D SL I+ GE+ VI+G SGSGK+T++ +++ +I P G++ + + + DAE Sbjct: 17 IQDLSLEIKNGELLVIVGQSGSGKTTLLNMMSGIITPESGEIFYNQQKLT-MEDAEQL-- 73 Query: 104 RRKKIAMVFQSFALMPHMTVLDNTAFGMELAGIN--AEERREKALDALRQVGLE-NYAHS 160 R K V QS +L PH+TVL+N EE+ EK + +QV L+ + Sbjct: 74 -RLKSGYVLQSSSLFPHLTVLENLFIQPRARQEKWTKEEQMEKGKELCQQVQLDPSCLTQ 132 Query: 161 YPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKH-QRTIV 219 YP ELSGG +QRV +ARALA P +L+DE FSALDP IR ++QD L++L H T V Sbjct: 133 YPKELSGGQQQRVSIARALANQPQFILLDEPFSALDPFIRKQLQDLLLELHKTHLDITFV 192 Query: 220 FISHDLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFFRGVDI 270 ++HD++EA+++GDRIA++ G++ QVG+P EI++ P +V F G ++ Sbjct: 193 MVTHDMEEALKLGDRIAVLHEGKLEQVGSPKEIMDQPKTAFVEELFAGKNL 243 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 312 Length adjustment: 29 Effective length of query: 371 Effective length of database: 283 Effective search space: 104993 Effective search space used: 104993 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory