Align sorbitol dehydrogenase, D-fructose forming (EC 1.1.1.14) (characterized)
to candidate WP_040388552.1 C683_RS01375 SDR family oxidoreductase
Query= reanno::BFirm:BPHYT_RS16120 (260 letters) >NCBI__GCF_000313915.1:WP_040388552.1 Length = 273 Score = 121 bits (304), Expect = 1e-32 Identities = 92/262 (35%), Positives = 134/262 (51%), Gaps = 11/262 (4%) Query: 4 RLQDKVAILTGAASGIGEAVARRYLDEGARCVLVDVKPADSFG--DSLRATYGDRVLTVS 61 R +DKV I+TGAA GIG+A A R EGA+ VL D K S + ++ D V Sbjct: 10 RFKDKVMIITGAAGGIGKACAIRAAKEGAKLVLGDQKEEMSQETLEEIQKITPDVDFLVG 69 Query: 62 ADVTRRDDIQRIVASTLERFGQIDILFNNAALFDM-RPILEESWDVFDRLFAVNVKGMFF 120 D+ + Q +V + +E++G+IDIL NNA + + P+ E S ++F + N+ F+ Sbjct: 70 -DLCEEKNCQALVQTAIEKYGRIDILVNNAGITGIPAPVHEMSEEMFRHVLDSNIMIAFY 128 Query: 121 LMQAVAQKMVEQGCGGKIINMSSQAGRRGEALVSHYCATKAAVLSYTQSAALALAPHKIN 180 +A M+EQ G IIN+SS AG G S Y +K + T++ AL A + I Sbjct: 129 CSKATLPYMMEQH-NGSIINVSSVAGLTGFPGHSAYVTSKHGLNGLTRNMALDYASYGIR 187 Query: 181 VNGIAPGVVDTPMWNEVDALFARYENRPLGEKKR-----LVGEAV-PLGRMGVPDDLTGA 234 VN + PG TPM++E A A + E + G+ V P R+ +++ Sbjct: 188 VNAVNPGTTQTPMYDEALAFLASKREKAAKEGTEPEDNIVQGKTVSPQKRVAAAEEVANG 247 Query: 235 ALFLASADADYITAQTLNVDGG 256 LFLAS +A IT L VDGG Sbjct: 248 ILFLASEEASNITGVYLPVDGG 269 Lambda K H 0.321 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 273 Length adjustment: 25 Effective length of query: 235 Effective length of database: 248 Effective search space: 58280 Effective search space used: 58280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory