Align Aromatic amino acid:H+ symporter, AroP of 457 aas and 12 TMSs (Cosgriff and Pittard 1997). Transports phenylalanine, tyrosine and tryptophan (characterized)
to candidate WP_009490181.1 C683_RS03825 amino acid permease
Query= TCDB::P15993 (457 letters) >NCBI__GCF_000313915.1:WP_009490181.1 Length = 448 Score = 385 bits (990), Expect = e-111 Identities = 182/444 (40%), Positives = 287/444 (64%), Gaps = 4/444 (0%) Query: 9 EQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAGPGIILGYAIAGFIAFLIMRQLGE 68 E+L+RGL NRH+QLI++GGAIGTGLFL S I AGP ++L Y I G F IMR LGE Sbjct: 4 EKLERGLSNRHVQLISIGGAIGTGLFLASGKSIAIAGPSVLLAYMIVGMFVFFIMRSLGE 63 Query: 69 MVVEEPVAGSFSHFAYKYWGSFAGFASGWNYWVLYVLVAMAELTAVGKYIQFWYPEIPTW 128 +++ SF A++Y G F +GW YW ++ VAM++LTAVG Y+++W+P +P W Sbjct: 64 LLLANLDCHSFVELAHQYLGRRWAFVTGWTYWFCWITVAMSDLTAVGMYMRYWFPHLPQW 123 Query: 129 VSAAVFFVVINAINLTNVKVFGEMEFWFAIIKVIAVVAMIIFGGWLLFSGN---GGPQAT 185 + A + + + A+NL +VK+FGE+EFW A+IK++A+VA+I G +++F+ + G A+ Sbjct: 124 IPALLMLLFLMALNLLSVKLFGEIEFWLALIKILAIVALIGVGLYMIFTHHKLENGIVAS 183 Query: 186 VSNLWDQGGFLPHGFTGLVMMMAIIMFSFGGLELVGITAAEADNPEQSIPKATNQVIYRI 245 +NL+ GGF PHGF+G ++ + +FSF G+ELVG+TA E +PE+++PKA N + RI Sbjct: 184 FANLYQDGGFFPHGFSGFILSFQLAVFSFTGVELVGLTAGETQDPEKTLPKAINNIPVRI 243 Query: 246 LIFYIGSLAVLLSLMPWTRVTADTSPFVLIFHELGDTFVANALNIVVLTAALSVYNSCVY 305 L+FY+GSLAV++++ PW + SPFV +F +G A+ +N VVL++A S NS ++ Sbjct: 244 LLFYVGSLAVIMAVQPWNIIDPTQSPFVTVFSSIGIAAAASIINFVVLSSAASACNSALF 303 Query: 306 CNSRMLFGLAQQGNAPKALASVDKRGVPVNTILVSALVTALCVLINYLAPESAFGLLMAL 365 SRML+GLA+ NAPK A ++K P +L+S++V + +++NY+ PE F L+ + Sbjct: 304 STSRMLYGLAKDDNAPKTFAKLNKNSTPAMALLMSSVVVGITIVLNYVMPEGVFSLISGI 363 Query: 366 VVSALVINWAMISLAHMKFRRAKQEQGVVTRFPALLYPLGNWICLLFMAAVLVIMLMTPG 425 + W +I + HMKF + +++ +F + N + L+F+A ++VI + Sbjct: 364 STVCFLFIWTIIVICHMKFLKQTKDED-RPKFRLKGAKVINILSLIFLALIIVICAVLES 422 Query: 426 MAISVYLIPVWLIVLGIGYLFKEK 449 I++++ P+W I L I Y K K Sbjct: 423 TRIALFITPIWFIALLIIYQVKFK 446 Lambda K H 0.328 0.141 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 531 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 457 Length of database: 448 Length adjustment: 33 Effective length of query: 424 Effective length of database: 415 Effective search space: 175960 Effective search space used: 175960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory