Align SDR family oxidoreductase (characterized, see rationale)
to candidate WP_009489301.1 C683_RS02490 3-oxoacyl-ACP reductase
Query= uniprot:A0A4P7ABK7 (254 letters) >NCBI__GCF_000313915.1:WP_009489301.1 Length = 242 Score = 133 bits (334), Expect = 4e-36 Identities = 87/246 (35%), Positives = 129/246 (52%), Gaps = 16/246 (6%) Query: 11 KTVLITAAAQGIGRASTELFAREGARVIATDISKTHLEELASIAGVETHLLDVTDDDAIK 70 ++V+IT + GIG+A E F +GA V D LE L D+T + ++ Sbjct: 9 QSVVITGCSSGIGKAQAEAFLDKGAMVYGLDCQPCPLEH----PNFFFSLCDITKEKEVE 64 Query: 71 ALVAKVGTVDVLFNCAGYVAA-GNILECDDKAWDFSFNLNAKAMFHTIRAVLPGMLAKKA 129 ++ K+ VD+L N AG + L+ + +D F +N + F A LP MLA+ Sbjct: 65 KVLQKIERVDILCNTAGILDDFAPSLDTSVELFDRIFAVNVRGTFLLCNACLPKMLAQGK 124 Query: 130 GSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADFVSQGIRCNAICPGTIESPSL 189 G I+N+AS AS + G AY ASK A+ G TK + D+ +GIR NAI PG I +P + Sbjct: 125 GCIINMASIASLIPGGGGA-AYTASKHAIYGYTKQLTYDYARKGIRANAIAPGAIRTP-M 182 Query: 190 NQRISTQAKETGKSEDEVRAAFVARQ-PMGRIGKAEEVAALALYLASDESNFTTGSIHMI 248 NQ+ E K +A++ P GR + EE+A + L+LASD++ + G I + Sbjct: 183 NQKDFLNGGEIAKE--------IAKETPCGRYAEPEEIAQVTLFLASDDARYIYGDIIPV 234 Query: 249 DGGWSN 254 DGGW N Sbjct: 235 DGGWMN 240 Lambda K H 0.316 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 242 Length adjustment: 24 Effective length of query: 230 Effective length of database: 218 Effective search space: 50140 Effective search space used: 50140 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory