Align SDR family oxidoreductase (characterized, see rationale)
to candidate WP_040388552.1 C683_RS01375 SDR family oxidoreductase
Query= uniprot:A0A4P7ABK7 (254 letters) >NCBI__GCF_000313915.1:WP_040388552.1 Length = 273 Score = 120 bits (301), Expect = 3e-32 Identities = 88/270 (32%), Positives = 141/270 (52%), Gaps = 19/270 (7%) Query: 1 MSASTGRLAGKTVLITAAAQGIGRASTELFAREGARVIATD----ISKTHLEELASIA-G 55 M R K ++IT AA GIG+A A+EGA+++ D +S+ LEE+ I Sbjct: 4 MDIIPNRFKDKVMIITGAAGGIGKACAIRAAKEGAKLVLGDQKEEMSQETLEEIQKITPD 63 Query: 56 VETHLLDVTDDDAIKALVA----KVGTVDVLFNCAGYVAA-GNILECDDKAWDFSFNLNA 110 V+ + D+ ++ +ALV K G +D+L N AG + E ++ + + N Sbjct: 64 VDFLVGDLCEEKNCQALVQTAIEKYGRIDILVNNAGITGIPAPVHEMSEEMFRHVLDSNI 123 Query: 111 KAMFHTIRAVLPGMLAKKAGSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADFV 170 F+ +A LP M+ + GSI+N++S A + G AY SK + GLT+++A D+ Sbjct: 124 MIAFYCSKATLPYMMEQHNGSIINVSSVAG-LTGFPGHSAYVTSKHGLNGLTRNMALDYA 182 Query: 171 SQGIRCNAICPGTIESPSLNQRIS-------TQAKETGKSEDEVRAAFVARQPMGRIGKA 223 S GIR NA+ PGT ++P ++ ++ AKE + ED + P R+ A Sbjct: 183 SYGIRVNAVNPGTTQTPMYDEALAFLASKREKAAKEGTEPEDNIVQGKTV-SPQKRVAAA 241 Query: 224 EEVAALALYLASDESNFTTGSIHMIDGGWS 253 EEVA L+LAS+E++ TG +DGG++ Sbjct: 242 EEVANGILFLASEEASNITGVYLPVDGGFT 271 Lambda K H 0.316 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 273 Length adjustment: 25 Effective length of query: 229 Effective length of database: 248 Effective search space: 56792 Effective search space used: 56792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory