Align D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized)
to candidate WP_040388552.1 C683_RS01375 SDR family oxidoreductase
Query= BRENDA::B8H1Z0 (248 letters) >NCBI__GCF_000313915.1:WP_040388552.1 Length = 273 Score = 88.2 bits (217), Expect = 2e-22 Identities = 73/261 (27%), Positives = 122/261 (46%), Gaps = 25/261 (9%) Query: 10 KGKRVVITGGGSGIGAGLTAGFARQGAEVIFLDIADEDSRALEAELAGSPIPP-----VY 64 K K ++ITG GIG A++GA+++ D +E S+ E+ I P V Sbjct: 12 KDKVMIITGAAGGIGKACAIRAAKEGAKLVLGDQKEEMSQETLEEI--QKITPDVDFLVG 69 Query: 65 KRCDLMNLEA-IKAVFAEIGDVDVLVNNAG-NDDRHKLADVTGAYWDERINVNLRHMLFC 122 C+ N +A ++ + G +D+LVNNAG + +++ + ++ N+ +C Sbjct: 70 DLCEEKNCQALVQTAIEKYGRIDILVNNAGITGIPAPVHEMSEEMFRHVLDSNIMIAFYC 129 Query: 123 TQAVAPGMKKRGGGAVINFGSISWHLGLEDLVLYETAKAGIEGMTRALARELGPDDIRVT 182 ++A P M ++ G++IN S++ G Y T+K G+ G+TR +A + IRV Sbjct: 130 SKATLPYMMEQHNGSIINVSSVAGLTGFPGHSAYVTSKHGLNGLTRNMALDYASYGIRVN 189 Query: 183 CVVPGNVKTKRQEKWYT-------------PEGEAQIVAAQCL---KGRIVPENVAALVL 226 V PG +T ++ E E IV + + K E VA +L Sbjct: 190 AVNPGTTQTPMYDEALAFLASKREKAAKEGTEPEDNIVQGKTVSPQKRVAAAEEVANGIL 249 Query: 227 FLASDDASLCTGHEYWIDAGW 247 FLAS++AS TG +D G+ Sbjct: 250 FLASEEASNITGVYLPVDGGF 270 Lambda K H 0.319 0.137 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 273 Length adjustment: 24 Effective length of query: 224 Effective length of database: 249 Effective search space: 55776 Effective search space used: 55776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory