Align ABC transporter for Glycerol, ATPase component 1 (characterized)
to candidate WP_008411393.1 DESHY_RS06575 ABC transporter ATP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_791 (363 letters) >NCBI__GCF_000315365.1:WP_008411393.1 Length = 227 Score = 130 bits (328), Expect = 3e-35 Identities = 71/195 (36%), Positives = 118/195 (60%), Gaps = 4/195 (2%) Query: 21 MSLALQSGAVTVLLGATQAGKTSLMRIMAGLDAPTAGRVTVDGKDV----TGMPVRDRNV 76 ++L++ G + +LG + +GK++++R++AGL+ P +G + +D K + T + +R V Sbjct: 23 VNLSISRGEIIAILGQSGSGKSTILRLLAGLEKPCSGTIVIDNKVMFDNNTYVNPENRGV 82 Query: 77 AMVYQQFINYPSMKVAANIASPLKLRGEKNIDARVREIASRLHIDMFLDRYPAELSGGQQ 136 MV+Q + +P M V NI L K R++E+ + ++++ F DRYP ELSGGQQ Sbjct: 83 GMVFQDYALFPHMTVEKNIIYGLAKLDRKERTKRLKEVLTLVNLEEFRDRYPYELSGGQQ 142 Query: 137 QRVALARALAKGAPLMLLDEPLVNLDYKLREELREELTQLFAAGQSTVVYATTEPGEALL 196 QRVALARALA ++LLDEP NLD LR ++R+EL ++ T ++ T + +A+ Sbjct: 143 QRVALARALAPKPAVLLLDEPFSNLDADLRCKIRDELKRIIKDVGITSIFVTHDQEDAIS 202 Query: 197 LGGYTAVLDEGQLLQ 211 L L +G +L+ Sbjct: 203 LADRVVYLHKGTVLK 217 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 137 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 227 Length adjustment: 26 Effective length of query: 337 Effective length of database: 201 Effective search space: 67737 Effective search space used: 67737 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory