Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_008410242.1 DESHY_RS02740 ectoine/hydroxyectoine ABC transporter ATP-binding protein EhuA
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_000315365.1:WP_008410242.1 Length = 263 Score = 149 bits (375), Expect = 1e-40 Identities = 87/240 (36%), Positives = 144/240 (60%), Gaps = 14/240 (5%) Query: 4 IIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELY 63 +I +NV K F GK+ L +++ ++ GE I+GPSG+GK+TF+R I L+ +G + Sbjct: 2 VIAENVRKNF--GKLQVLKGISLEVKQGEVVVIIGPSGSGKSTFLRCINHLEARDSGVVE 59 Query: 64 FDDRLVA---SNGKLIVPPEDR-------KIGMVFQTWALYPNLTAFENIAF-PLTNMKM 112 D + V S G ++P + + IGMVFQ + L+P++TA N+ P+T + Sbjct: 60 VDGQPVGFSQSAGGRLLPVKGKDLCRLRSSIGMVFQRFNLFPHMTALANVMEGPVTVLGK 119 Query: 113 SKEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLD 172 S++E R+ EE+ + + + FP +LSGGQQQRVA+ARAL P L+L DEP S LD Sbjct: 120 SRQEARQLAEELLAKVGLADKADSFPSQLSGGQQQRVAIARALAMKPKLMLFDEPTSALD 179 Query: 173 ARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNP 232 + A++K + + G+T+++V+H+ +ADRV + +GK+++ G PE ++ +P Sbjct: 180 PELVGEVLAVIKNLAAE-GMTMIIVTHEMGFAREVADRVVFMDEGKIIESGTPEQIFTSP 238 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 259 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 353 Length of database: 263 Length adjustment: 27 Effective length of query: 326 Effective length of database: 236 Effective search space: 76936 Effective search space used: 76936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory