Align ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized)
to candidate WP_008410242.1 DESHY_RS02740 ectoine/hydroxyectoine ABC transporter ATP-binding protein EhuA
Query= TCDB::Q9R9Q4 (342 letters) >NCBI__GCF_000315365.1:WP_008410242.1 Length = 263 Score = 159 bits (402), Expect = 7e-44 Identities = 97/246 (39%), Positives = 135/246 (54%), Gaps = 18/246 (7%) Query: 8 DIRKSFGAFDVIKGVSMEIKPGEFMVFVGPSGCGKSTLLRLIAGLEEITSGTLAFDGQIV 67 ++RK+FG V+KG+S+E+K GE +V +GPSG GKST LR I LE SG + DGQ V Sbjct: 6 NVRKNFGKLQVLKGISLEVKQGEVVVIIGPSGSGKSTFLRCINHLEARDSGVVEVDGQPV 65 Query: 68 ---------------NQLTPSRRGIAMVFQSYALYPHMTVYENMAFG-MQLAGKDKQQCR 111 L R I MVFQ + L+PHMT N+ G + + GK +Q+ R Sbjct: 66 GFSQSAGGRLLPVKGKDLCRLRSSIGMVFQRFNLFPHMTALANVMEGPVTVLGKSRQEAR 125 Query: 112 KRVEAAAEMLQLTPYLERLPRQLSGGQRQRVAIGRAIVRDPKVFLFDEPLSNLDAALRVA 171 + E + L + P QLSGGQ+QRVAI RA+ PK+ LFDEP S LD L V Sbjct: 126 QLAEELLAKVGLADKADSFPSQLSGGQQQRVAIARALAMKPKLMLFDEPTSALDPEL-VG 184 Query: 172 TRLEIAKLHRSMHKTTMIYVTHDQVEAMTLADRICVLRDGLVEQIGTPLELYETPNSVFV 231 L + K + + TMI VTH+ A +ADR+ + +G + + GTP +++ +P Sbjct: 185 EVLAVIK-NLAAEGMTMIIVTHEMGFAREVADRVVFMDEGKIIESGTPEQIFTSPRHPRT 243 Query: 232 AGFIGS 237 F+ S Sbjct: 244 REFLSS 249 Lambda K H 0.321 0.138 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 342 Length of database: 263 Length adjustment: 27 Effective length of query: 315 Effective length of database: 236 Effective search space: 74340 Effective search space used: 74340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory