Align Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized)
to candidate WP_048818108.1 DESHY_RS11945 ATP-binding cassette domain-containing protein
Query= SwissProt::Q9YGA6 (372 letters) >NCBI__GCF_000315365.1:WP_048818108.1 Length = 221 Score = 159 bits (403), Expect = 5e-44 Identities = 82/194 (42%), Positives = 123/194 (63%), Gaps = 2/194 (1%) Query: 28 DGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDKLVADPEKGIFVPPKDRDIAMVF 87 + E ++L GPSG GKTT L +AGL +PS G I + +++ E I + P+DR++ +F Sbjct: 25 NNEILVLWGPSGAGKTTILHCLAGLVKPSSGLIRLNKQVLYSSEDKIHLSPQDRNVGYLF 84 Query: 88 QSYALYPHMTVYDNIAFPLKLRKVPRQEIDQRVREVAELLGLTELLNRKPRELSGGQRQR 147 Q YAL+PHMTV N+ + L+ +K + I+ E+ G+ L +R PR+LSGG++QR Sbjct: 85 QDYALFPHMTVRQNVMYGLRSKKTFQSNINPV--EILNSFGVGHLTDRYPRQLSGGEKQR 142 Query: 148 VALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQRQLGVTTIYVTHDQVEAMTMG 207 VAL RA+ +P++ L+DEP S LD + +R E+KKL RQ + I VTHD+ + +G Sbjct: 143 VALARALAVQPKLLLLDEPFSALDKSTKESLRQEVKKLHRQWQIPFILVTHDEADTHYLG 202 Query: 208 DRIAVMNRGVLQQV 221 DRI +N+G QV Sbjct: 203 DRIISLNKGQPCQV 216 Lambda K H 0.323 0.142 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 372 Length of database: 221 Length adjustment: 26 Effective length of query: 346 Effective length of database: 195 Effective search space: 67470 Effective search space used: 67470 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory