Align PotG aka B0855, component of Putrescine porter (characterized)
to candidate WP_008410843.1 DESHY_RS13325 ABC transporter ATP-binding protein
Query= TCDB::P31134 (377 letters) >NCBI__GCF_000315365.1:WP_008410843.1 Length = 363 Score = 162 bits (410), Expect = 1e-44 Identities = 102/306 (33%), Positives = 162/306 (52%), Gaps = 6/306 (1%) Query: 19 LLEIRNLTKSYDGQHAVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEQPSAGQIML 78 +L+++NL G+ +D + ++KGE AL+G +G GKS+L+++LA E+P G+I+ Sbjct: 7 ILQVKNLCWGVAGRTLIDIDNFVLHKGETIALIGPNGAGKSSLVKLLALLEKPWQGEIIF 66 Query: 79 DGVDLSQVPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQDKLPKAEIASRVNEMLGLVH 138 DG ++ P +R M AL +V N+A GL+ LP+ +IA RVN L + Sbjct: 67 DGRQVTGSPLQVRRQMAMVFQEALLLSGSVFGNVAQGLRFRGLPRDQIARRVNYWLKKLQ 126 Query: 139 MQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRMQLEVVDILER 198 + A R LSGG+ QRV++AR+LA P++L LDEP ALD R + E+ +I++ Sbjct: 127 IAHLADRHIRYLSGGEAQRVSIARALALEPQVLFLDEPFAALDLPTRITLIEEIGEIIKA 186 Query: 199 VGVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEHPTTRYSAEFIGSVNVFEG 258 V +TH+ EE +AGR+ M+ GK VQ E+I+ +P A +G NV +G Sbjct: 187 TATATVFITHNVEEIPLLAGRVCAMSAGKIVQDCSTEDIFRYPVNEEVARLVGIENVLQG 246 Query: 259 VLKERQEDGLVLDSPGLVHPLKVDADASVVDNVPVHVALRPEKIMLCEE-PPANGCNFAV 317 V+ V ++ + A +++ +RPE ++L E+ P G N Sbjct: 247 VVLPGGRTAQVGET-----VISFVARQDYRPGTNINLCIRPEDVILIEDRKPDGGPNLCR 301 Query: 318 GEVIHI 323 G V I Sbjct: 302 GRVTKI 307 Lambda K H 0.321 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 311 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 363 Length adjustment: 30 Effective length of query: 347 Effective length of database: 333 Effective search space: 115551 Effective search space used: 115551 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory