Align PotG aka B0855, component of Putrescine porter (characterized)
to candidate WP_048817941.1 DESHY_RS05510 methionine ABC transporter ATP-binding protein
Query= TCDB::P31134 (377 letters) >NCBI__GCF_000315365.1:WP_048817941.1 Length = 341 Score = 161 bits (407), Expect = 3e-44 Identities = 94/261 (36%), Positives = 155/261 (59%), Gaps = 12/261 (4%) Query: 19 LLEIRNLTKSYDGQH----AVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEQPSAG 74 +++I++LTK Y A+D V+L + KGEI+ ++G SG GKSTL+R + EQP++G Sbjct: 1 MIQIQDLTKIYRSAAGAVTALDHVNLRVRKGEIYGIIGYSGAGKSTLIRCVNMLEQPTSG 60 Query: 75 QIMLDGVDLS-----QVPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQDKLPKAEIASR 129 I ++G +++ Q+ R I M+FQ + L TV +N+AF L+ +PKA+I + Sbjct: 61 SIKVNGQEITSLNETQLRVARRKIGMIFQHFNLLSSRTVFENVAFPLEISGVPKAQIKEK 120 Query: 130 VNEMLGLVHMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRMQ 189 V ++LGLV + + A P QLSGGQ+QRV +AR+LA P +LL DE ALD D + Sbjct: 121 VTKLLGLVGLSDKAGAYPSQLSGGQKQRVGIARALANDPIVLLCDEATSALDPATTDSIL 180 Query: 190 LEVVDILERVGVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIY---EHPTTRYS 246 + DI R+ +T +M+TH+ + + +A++ +GK ++ G +++ +HPTTR Sbjct: 181 ALLKDINRRLDLTILMITHEMKVISEICDSVAVLEQGKVIEEGLVIDVFTQPQHPTTRRF 240 Query: 247 AEFIGSVNVFEGVLKERQEDG 267 + I ++ E + K + G Sbjct: 241 VQTIIQTDIPEHIKKPLLQRG 261 Lambda K H 0.321 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 299 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 341 Length adjustment: 29 Effective length of query: 348 Effective length of database: 312 Effective search space: 108576 Effective search space used: 108576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory