Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate WP_009130737.1 HMPREF9447_RS15730 ABC transporter ATP-binding protein
Query= CharProtDB::CH_088321 (255 letters) >NCBI__GCF_000315485.1:WP_009130737.1 Length = 333 Score = 132 bits (331), Expect = 1e-35 Identities = 76/239 (31%), Positives = 127/239 (53%), Gaps = 5/239 (2%) Query: 3 LRTENLTVSYGTDK----VLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGT 58 + NL + Y K V +S L G++T L+G NG GKSTLL + SG Sbjct: 6 ITANNLCIGYRQGKQEKRVHEHLSFQLYPGELTCLLGANGTGKSTLLRTLAASQPALSGE 65 Query: 59 VFLGDNPINMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNAR 118 + + D P++ S ++ +R + ++ G+TV ELV+ GR P +GRL+ D+A Sbjct: 66 LLVEDKPLSAYSEKERSRTIGVVLTDKTQAGGLTVYELVALGRQPHTGFFGRLNKADHAI 125 Query: 119 VNVAMNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLM 178 + A+ I+H A ELS G+RQ+ +A L Q P++LLDEPT +LD+ ++++M Sbjct: 126 IEEALEAVSISHKAQSYTAELSDGERQKVMIAKALVQECPLILLDEPTAFLDVVSRIEIM 185 Query: 179 RLMGELRT-QGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFS 236 L+ L Q K ++ HD+ QA D+L +++ + + G E+++ + +FS Sbjct: 186 TLLHRLAVEQSKAILLSTHDIEQALVLADKLWLLSKENGLQCGVTEDMILSHRMDGLFS 244 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 333 Length adjustment: 26 Effective length of query: 229 Effective length of database: 307 Effective search space: 70303 Effective search space used: 70303 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory