GapMind for catabolism of small carbon sources

 

Protein WP_007664459.1 in Cronobacter condimenti 1330

Annotation: NCBI__GCF_000319285.1:WP_007664459.1

Length: 321 amino acids

Source: GCF_000319285.1 in NCBI

Candidate for 36 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-ribose catabolism rbsC hi Ribose import permease protein RbsC (characterized) 92% 100% 565.1 RbsC, component of The probable autoinducer-2 (AI-2;, a furanosyl borate diester: 3aS,6S,6aR)-2,2,6,6a-tetrahydroxy-3a-methyltetrahydrofuro[3,2-d][1,3,2]dioxaborolan-2-uide) uptake porter (Shao et al., 2007) (50-70% identical to RbsABC of E. coli; TC# 3.A.1.2.1) 69% 421.4
xylitol catabolism PS417_12060 med ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family; SubName: Full=Sugar ABC transporter permease (characterized, see rationale) 50% 93% 279.3 Ribose import permease protein RbsC 92% 565.1
D-mannose catabolism HSERO_RS03645 med ABC-type sugar transport system, permease component protein (characterized, see rationale) 42% 91% 241.9 Ribose import permease protein RbsC 92% 565.1
L-fucose catabolism HSERO_RS05255 med ABC-type sugar transport system, permease component protein (characterized, see rationale) 43% 90% 237.7 Ribose import permease protein RbsC 92% 565.1
myo-inositol catabolism iatP med Inositol ABC transport system, permease protein IatP, component of The myoinositol (high affinity)/ D-ribose (low affinity) transporter IatP/IatA/IbpA. The structure of IbpA with myoinositol bound has been solved (characterized) 44% 93% 236.9 Ribose import permease protein RbsC 92% 565.1
D-fructose catabolism frcC med Ribose ABC transport system, permease protein RbsC (characterized, see rationale) 48% 88% 233.4 Ribose import permease protein RbsC 92% 565.1
sucrose catabolism frcC med Ribose ABC transport system, permease protein RbsC (characterized, see rationale) 48% 88% 233.4 Ribose import permease protein RbsC 92% 565.1
D-cellobiose catabolism mglC med Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 41% 98% 222.6 Ribose import permease protein RbsC 92% 565.1
D-glucose catabolism mglC med Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 41% 98% 222.6 Ribose import permease protein RbsC 92% 565.1
lactose catabolism mglC med Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 41% 98% 222.6 Ribose import permease protein RbsC 92% 565.1
D-maltose catabolism mglC med Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 41% 98% 222.6 Ribose import permease protein RbsC 92% 565.1
sucrose catabolism mglC med Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 41% 98% 222.6 Ribose import permease protein RbsC 92% 565.1
trehalose catabolism mglC med Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 41% 98% 222.6 Ribose import permease protein RbsC 92% 565.1
D-xylose catabolism xylH med Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 41% 98% 222.6 Ribose import permease protein RbsC 92% 565.1
myo-inositol catabolism PS417_11895 med Inositol transport system permease protein (characterized) 41% 96% 218.8 Ribose import permease protein RbsC 92% 565.1
D-xylose catabolism xylF_Tm med ABC-type transporter, integral membrane subunit, component of Xylose porter (Nanavati et al. 2006). Regulated by xylose-responsive regulator XylR (characterized) 41% 96% 211.1 Ribose import permease protein RbsC 92% 565.1
L-arabinose catabolism araH lo L-arabinose ABC transporter, permease protein AraH (characterized) 35% 97% 210.3 Ribose import permease protein RbsC 92% 565.1
D-galactose catabolism BPHYT_RS16925 lo Arabinose ABC transporter permease (characterized, see rationale) 36% 94% 209.1 Ribose import permease protein RbsC 92% 565.1
D-galactose catabolism ytfT lo Galactofuranose transporter permease protein YtfT (characterized) 38% 93% 199.1 Ribose import permease protein RbsC 92% 565.1
D-galactose catabolism mglC lo MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized) 37% 97% 198.4 Ribose import permease protein RbsC 92% 565.1
L-arabinose catabolism araWsh lo Inner-membrane translocator (characterized, see rationale) 35% 75% 188 Ribose import permease protein RbsC 92% 565.1
D-mannose catabolism frcC lo Fructose import permease protein FrcC (characterized) 34% 84% 183.3 Ribose import permease protein RbsC 92% 565.1
D-ribose catabolism frcC lo Fructose import permease protein FrcC (characterized) 34% 84% 183.3 Ribose import permease protein RbsC 92% 565.1
L-rhamnose catabolism rhaP lo RhaP, component of Rhamnose porter (Richardson et al., 2004) (Transport activity is dependent on rhamnokinase (RhaK; AAQ92412) activity (Richardson and Oresnik, 2007) This could be an example of group translocation!) (characterized) 34% 92% 182.6 Ribose import permease protein RbsC 92% 565.1
D-fructose catabolism fruF lo Fructose import permease protein FruF (characterized) 34% 88% 179.9 Ribose import permease protein RbsC 92% 565.1
sucrose catabolism fruF lo Fructose import permease protein FruF (characterized) 34% 88% 179.9 Ribose import permease protein RbsC 92% 565.1
D-galactose catabolism yjtF lo Inner membrane ABC transporter permease protein YjfF (characterized) 39% 85% 177.2 Ribose import permease protein RbsC 92% 565.1
L-fucose catabolism BPHYT_RS34240 lo Monosaccharide-transporting ATPase; EC 3.6.3.17; Flags: Precursor (characterized, see rationale) 35% 87% 175.6 Ribose import permease protein RbsC 92% 565.1
L-rhamnose catabolism BPHYT_RS34240 lo Monosaccharide-transporting ATPase; EC 3.6.3.17; Flags: Precursor (characterized, see rationale) 35% 87% 175.6 Ribose import permease protein RbsC 92% 565.1
D-fructose catabolism fruG lo Fructose import permease protein FruG (characterized) 34% 97% 172.9 Ribose import permease protein RbsC 92% 565.1
sucrose catabolism fruG lo Fructose import permease protein FruG (characterized) 34% 97% 172.9 Ribose import permease protein RbsC 92% 565.1
L-arabinose catabolism araZsh lo Inner-membrane translocator (characterized, see rationale) 35% 98% 171.4 Ribose import permease protein RbsC 92% 565.1
2'-deoxyinosine catabolism H281DRAFT_01112 lo deoxynucleoside transporter, permease component 2 (characterized) 33% 82% 156.8 Ribose import permease protein RbsC 92% 565.1
L-rhamnose catabolism rhaQ lo RhaQ (characterized, see rationale) 31% 87% 138.3 Ribose import permease protein RbsC 92% 565.1
L-arabinose catabolism xylHsa lo Xylose/arabinose import permease protein XylH (characterized, see rationale) 30% 83% 137.5 Ribose import permease protein RbsC 92% 565.1
2'-deoxyinosine catabolism H281DRAFT_01115 lo deoxynucleoside transporter, permease component 1 (characterized) 32% 84% 129 Ribose import permease protein RbsC 92% 565.1

Sequence Analysis Tools

View WP_007664459.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MTTQTVATRRFFTKAWLMEQKSLIALLVLIAIVSTLSPNFFTVNNLLNILQQTSVNAIMA
VGMTLVILTSGIDLSVGSLLALTGAVAASLVGIEVNALVAVAAALALGAAIGAVTGAIVA
KGRVQAFIATLVMMLLLRGVTLEYTNGSPVSTGFNDNGDLFGWFGIGRPLGIPTPVWIMA
LVFLVTWYVLHHTRLGRYIYALGGNEAATRLSGISVNKIKIIVYSLSGLLASLAGVIEVA
RLSSAQPLAGVGYELDAIAAVVLGGTSLAGGKGRIVGTLIGALILGFLNNSLNLLGVSPY
YQMIVKAVVILLAVLVDNKKQ

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory