Align L-fucose-proton symporter; 6-deoxy-L-galactose permease; L-fucose permease (characterized)
to candidate WP_007671898.1 BN137_RS10460 sugar MFS transporter
Query= SwissProt::P11551 (438 letters) >NCBI__GCF_000319285.1:WP_007671898.1 Length = 408 Score = 276 bits (707), Expect = 7e-79 Identities = 158/399 (39%), Positives = 227/399 (56%), Gaps = 23/399 (5%) Query: 30 LLCSLFFLWAVANNLNDILLPQFQQAFTLTNFQAGLIQSAFYFGYFIIPIPAGILMKKLS 89 L+ SLFF+W ++ L D+L FQ+ ++ Q+GL+Q+A++ YF++ +PAG M+K Sbjct: 26 LVTSLFFMWGLSYGLLDVLNKHFQETLHVSKAQSGLLQAAYFGAYFLVALPAGYFMEKRG 85 Query: 90 YKAGIITGLFLYALGAALFWPAAEIMNYTLFLVGLFIIAAGLGCLETAANPFVTVLGPES 149 YKAGI+ GL LYALGA LF PAA ++ LFL LF+IA GLGCLETAANP+ TVLG Sbjct: 86 YKAGILVGLCLYALGALLFVPAAGANSFMLFLFALFVIACGLGCLETAANPYATVLGDPQ 145 Query: 150 SGHFRLNLAQTFNSFGAIIAVVFGQSLILSNVPHQSQDVLDKMSPEQLSAYKHSLVLSVQ 209 RLNLAQ+FN G + + G +L S H + V+ Sbjct: 146 GAERRLNLAQSFNGLGQFMGPLIGGTLFFS-ATHNADGGQG----------------MVK 188 Query: 210 TPYMIIVAIVLLVALLIMLTKFPALQSDNHSDAKQGSFSASLSRLARIRHWRWAVLAQFC 269 Y+ I +VL++A L T P ++ + A Q S L + RH+ V+AQF Sbjct: 189 MTYVGIALLVLVIAFLFRRTPMPDIREAEETVAGQPS-----KGLWQHRHFTGGVVAQFF 243 Query: 270 YVGAQTACWSYLIRYAVEEIPGMTAGFAANYLTGTMVCFFIGRFTGTWLISRFAPHKVLA 329 YV AQ ++ I YA E G+T+ A+ L+ M+ F +GRF TWL+ R +L Sbjct: 244 YVAAQVGVGAFFINYATEHWQGVTSQHASYLLSVAMISFMVGRFFSTWLMGRVRAATLLV 303 Query: 330 AYALIAMALCLISAFAGGHVGLIALTLCSAFMSIQYPTIFSLGIKNLGQDTKYGSSFIVM 389 Y+L+ + LC + + V ++AL FMSI +PTIF+LG+KN+G TK SSF++M Sbjct: 304 LYSLVNIVLCGLVMMSIDGVSVVALIAVFFFMSIMFPTIFALGVKNMGSHTKRASSFMIM 363 Query: 390 TIIGGGIVTPVMGFVSDAAGNIPTAELIPALCFAVIFIF 428 I+GG I+ MG V+D+ + A +P LCF V+F + Sbjct: 364 AIVGGAIMPYFMGAVADSY-STAVAYGLPLLCFIVVFFY 401 Lambda K H 0.329 0.140 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 477 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 438 Length of database: 408 Length adjustment: 32 Effective length of query: 406 Effective length of database: 376 Effective search space: 152656 Effective search space used: 152656 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory