Align PTS system mannose-specific EIID component; EII-M-Man; EIID-Man; Mannose permease IID component (characterized)
to candidate WP_007668606.1 BN137_RS13785 PTS mannose transporter subunit IID
Query= SwissProt::P69805 (283 letters) >NCBI__GCF_000319285.1:WP_007668606.1 Length = 283 Score = 530 bits (1364), Expect = e-155 Identities = 259/282 (91%), Positives = 271/282 (96%) Query: 1 MVDTTQTTTEKKLTQSDIRGVFLRSNLFQGSWNFERMQALGFCFSMVPAIRRLYPENNEA 60 MVD T+TT EKKLT D+R VF+RSNLFQGSWNFERMQALGFCFSM+PAIRRLYPENNEA Sbjct: 1 MVDMTKTTGEKKLTPGDVRAVFIRSNLFQGSWNFERMQALGFCFSMIPAIRRLYPENNEA 60 Query: 61 RKQAIRRHLEFFNTQPFVAAPILGVTLALEEQRANGAEIDDGAINGIKVGLMGPLAGVGD 120 R+QAI+RHLEFFNT P+VAAP+LGVTLA+EEQRANGAEIDDGAING+KVGLMGPLAGVGD Sbjct: 61 RRQAIKRHLEFFNTHPYVAAPVLGVTLAMEEQRANGAEIDDGAINGLKVGLMGPLAGVGD 120 Query: 121 PIFWGTVRPVFAALGAGIAMSGSLLGPLLFFILFNLVRLATRYYGVAYGYSKGIDIVKDM 180 PIFWGTVRPVFAALGAGIAMSGSLLGPLLFF+LFNLVRLATRYYGVAYGY KG+DIVKDM Sbjct: 121 PIFWGTVRPVFAALGAGIAMSGSLLGPLLFFVLFNLVRLATRYYGVAYGYRKGVDIVKDM 180 Query: 181 GGGFLQKLTEGASILGLFVMGALVNKWTHVNIPLVVSRITDQTGKEHVTTVQTILDQLMP 240 GGGFLQKLTEGASILGLFVMGALVNKWTHVNIPLVVSRITDQ G E VTTVQTILDQLMP Sbjct: 181 GGGFLQKLTEGASILGLFVMGALVNKWTHVNIPLVVSRITDQNGAEKVTTVQTILDQLMP 240 Query: 241 GLVPLLLTFACMWLLRKKVNPLWIIVGFFVIGIAGYACGLLG 282 GLVPLLLTFACMWLLRKKVNPLWIIVGFFVIGIAGYA GLLG Sbjct: 241 GLVPLLLTFACMWLLRKKVNPLWIIVGFFVIGIAGYAIGLLG 282 Lambda K H 0.326 0.143 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 283 Length of database: 283 Length adjustment: 26 Effective length of query: 257 Effective length of database: 257 Effective search space: 66049 Effective search space used: 66049 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory