Align Rhizopine-binding protein (characterized, see rationale)
to candidate WP_007675902.1 BN137_RS06865 galactose/glucose ABC transporter substrate-binding protein MglB
Query= uniprot:A0A0N9WNI6 (308 letters) >NCBI__GCF_000319285.1:WP_007675902.1 Length = 331 Score = 130 bits (328), Expect = 3e-35 Identities = 98/300 (32%), Positives = 155/300 (51%), Gaps = 22/300 (7%) Query: 1 MKTKIRFASLALSLMLASGAALADLRIGVSMSQFDDTWLTYLRESMDKQAKSMPDGVKLQ 60 M K+ S +S ML AA A RIGV++ ++DD +++ +R++++K+A + D V+L Sbjct: 1 MNKKVLTLSAVMSCMLFGTAAQAADRIGVTIYKYDDNFMSVVRKAIEKEASASSD-VQLL 59 Query: 61 FEDARSDVVKQLSQVESFISQKVDAIVVNPVDTAATRKITEAAVKAGIPLVYVNRRPDDL 120 D+++D KQ Q++ +++ V ++ +N VD AA + E A IP+V+ N+ P Sbjct: 60 MNDSQNDQSKQNDQIDVLLAKGVKSLAINLVDPAAAGTVIEKARGQNIPIVFFNKEPSRK 119 Query: 121 KLPK--GVITVASNDLEAGQMQMQYLAEKMK----------GKGDIVILLGDLANNSTTN 168 L V ++ E+G +Q +A+ K G+ V+L G+ + Sbjct: 120 ALDSYDKAYYVGTDSKESGIIQGDLIAKHWKANANWDLNKDGQIQYVLLKGEPGHPDAEA 179 Query: 169 RTKGV-KEVLAKYPGIKIDQEQ--TGTWSRDKGMTLVNDWLT--QGRKFDAIVSNNDEMA 223 RT V KE+ K GIK Q Q T W + ++ WL+ K + +++NND MA Sbjct: 180 RTTYVIKELNDK--GIKTQQLQLDTAMWDTAQAKDKMDAWLSGPNANKIEVVIANNDAMA 237 Query: 224 IGAAMALKQAGVEKGSVLIAGVDGTPDGLRAVKKGDLAVSVFQDANGQAVDSIDAAVKMA 283 +GA ALK K SV + GVD P+ L VK G LA +V DAN QA + D A +A Sbjct: 238 MGAVEALKAHN--KSSVPVFGVDALPEALALVKSGALAGTVLNDANNQAKATFDLAKNLA 295 Lambda K H 0.315 0.130 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 331 Length adjustment: 28 Effective length of query: 280 Effective length of database: 303 Effective search space: 84840 Effective search space used: 84840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory