Align Monosaccharide-transporting ATPase; EC 3.6.3.17; Flags: Precursor (characterized, see rationale)
to candidate WP_007667712.1 BN137_RS14415 ABC transporter permease
Query= uniprot:B2T9V8 (351 letters) >NCBI__GCF_000319285.1:WP_007667712.1 Length = 333 Score = 159 bits (402), Expect = 1e-43 Identities = 101/309 (32%), Positives = 155/309 (50%), Gaps = 8/309 (2%) Query: 35 LARLRELALLPALALLIVIGAFISPSFLTKANLISVLGASAALALVVLAESLIVLTGKFD 94 L + RE L +AL++++ PSFL ANL+ + ++ L ++ L + +++LT D Sbjct: 4 LLKHREALLGLVIALMLLVIGSRVPSFLAPANLVEMFNDTSILIILALGQMMVLLTKGID 63 Query: 95 LSLESTVGIAPAVGAMLVMPAASAGFGMQWPAAAGLLAIVVVGAVIGFINGFLVVRLRLN 154 LS+ + + + + A++ P A L ++G ++G ING LV +L + Sbjct: 64 LSMAANLALTGMIVALINAHHPDI------PVALLLALATLLGLLMGVINGLLVWKLGIP 117 Query: 155 AFIVTLAMLIVLRGMLVGATKGGTL--FDMPTSFFALATTIVLGLPLSVWLAAAAFAIAA 212 A +VTL + V RG++ + G + M F L VLGLPL W A A + + Sbjct: 118 AIVVTLGTMSVYRGIIFLLSDGAWVNAHQMSADFLGLPRLPVLGLPLLGWCAIAVLLLVS 177 Query: 213 FMLRYHRLGRALYAIGGNPEAARAAGIRVERITWGVFVLGSILASVGGLIVTGYVGAINA 272 + LRY R GRALY GGN AA GI ++ + F L LA G + Sbjct: 178 YFLRYSRTGRALYTAGGNATAAYYTGINAGKMQFISFCLSGALAGFCGYLWISRFAMAYV 237 Query: 273 NQGNGMIFTVFAAAVIGGISLDGGKGTMFGALTGVLLLGVVQNLLTLAQVPSFWIQAIYG 332 + NG + AA VIGGIS GG G + G L G L LGV+ N L + V FW A+ G Sbjct: 238 DVANGFELQIVAACVIGGISTMGGIGRVAGCLLGALFLGVINNALPVVGVSPFWQMAVSG 297 Query: 333 AIILGSLMV 341 +I+ ++++ Sbjct: 298 VVIVVAVLL 306 Lambda K H 0.326 0.140 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 351 Length of database: 333 Length adjustment: 29 Effective length of query: 322 Effective length of database: 304 Effective search space: 97888 Effective search space used: 97888 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory