Align D-ribose transporter ATP-binding protein; SubName: Full=Putative xylitol transport system ATP-binding protein; SubName: Full=Sugar ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_007667715.1 BN137_RS14410 sugar ABC transporter ATP-binding protein
Query= uniprot:A0A1N7TX47 (495 letters) >NCBI__GCF_000319285.1:WP_007667715.1 Length = 503 Score = 339 bits (869), Expect = 2e-97 Identities = 191/492 (38%), Positives = 291/492 (59%), Gaps = 4/492 (0%) Query: 6 LLQAEHVAKAYAGVPALRDGRLSLRAGSVHALCGGNGAGKSTFLSILMGITQRDAGSILL 65 LL + + K + GV AL + +L L G V AL G NGAGKST + ++ GI Q D G IL Sbjct: 7 LLSLKGICKTFPGVRALENVQLELWPGRVTALIGENGAGKSTLVKVMTGIYQPDGGEILY 66 Query: 66 NGAPVQFNRPSEALAAGIAMITQELEPIPYMTVAENIWLGREPRRAGCI--VDNKALNRR 123 P+ P A GI I QE +TV ENI+ G + G +D A++R+ Sbjct: 67 KAIPITLPNPEAAHKVGITAIHQETVLFDELTVTENIFTGHYLVK-GLFKKLDWPAMHRQ 125 Query: 124 TRELLDSLEFDVDATSPMHRLSVAQIQLVEIAKAFSHDCQVMIMDEPTSAIGEHEAQTLF 183 R++L+ LE ++D + + LS+AQ +V IA+A S D QV+I+DEPT+A+ +HE + Sbjct: 126 ARDILNRLEVNIDPHAVLKTLSIAQRHMVAIARALSFDAQVVILDEPTAALSQHEILEFY 185 Query: 184 KAIRRLTAQGAGIVYVSHRLSELAQIADDYSIFRDGAFVESGRMADIDRDHLVRGIVGQE 243 + + RL +G I+++SH+ E+ ++AD Y+I RDG FV +G + DI + +V +VG+ Sbjct: 186 QIVERLKHEGKAILFISHKFDEIFELADHYTILRDGVFVSAGDITDITEERMVAMMVGRA 245 Query: 244 LTRIDHKVGRECAANTCLQVDNLSRAGEFHDISLQLRQGEILGIYGLMGSGRSEFLNCIY 303 +T+ KV E +T L+V +L EF I LR+GEILG YGL+G+GR+E + + Sbjct: 246 ITQTYPKVVCE-PGDTVLEVRDLCHPTEFAHIDFSLRKGEILGFYGLVGAGRTELMQALC 304 Query: 304 GLTVADSGSVTLQGKPMPIGLPKATINAGMSLVTEDRKDSGLVLTGSILSNIALSAYKRL 363 G+T SG + L GK M P I AG+ V E+R+ G ++ I NI+L RL Sbjct: 305 GVTRPSSGEIILNGKHMAFHQPADAIEAGIVCVPEERQKQGAIIELPIAQNISLPQLSRL 364 Query: 364 SSWSLINARKETQLAEDMVKRLQIKTTSLELPVASMSGGNQQKVVLAKCLSTEPVCLLCD 423 + +++ +E LA++ +RLQ+K + PV ++SGGNQQKVV+AK L+T P ++ D Sbjct: 365 NPNGILHDDREWALADEYARRLQVKASGWRQPVETLSGGNQQKVVIAKWLATRPEVIILD 424 Query: 424 EPTRGIDEGAKQEIYHLLDQFVRGGGAAIVVSSEAPELLHLSDRIAVFKGGRLVTISTDT 483 EPT+GID G+K ++ + + V G A I+VSSE PE++ ++DRI V G +V Sbjct: 425 EPTKGIDIGSKAAVHQFMSELVGQGLAVIMVSSELPEVMGMADRIIVMHEGLMVAEYAAG 484 Query: 484 ALSQEALLRLAS 495 + E+++ AS Sbjct: 485 KATAESIVSAAS 496 Lambda K H 0.319 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 564 Number of extensions: 29 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 495 Length of database: 503 Length adjustment: 34 Effective length of query: 461 Effective length of database: 469 Effective search space: 216209 Effective search space used: 216209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory