Align TRAP transporter, subunit DctM (characterized, see rationale)
to candidate WP_017548179.1 C792_RS0104105 TRAP transporter large permease
Query= uniprot:I7DRS6 (467 letters) >NCBI__GCF_000330705.1:WP_017548179.1 Length = 425 Score = 277 bits (708), Expect = 6e-79 Identities = 158/461 (34%), Positives = 260/461 (56%), Gaps = 36/461 (7%) Query: 1 MDVVLLFSMVIGLLLIGVPIAVALGLSSTLFLLIYSDSSLASVAGTLFEAFEGHFTLLAI 60 M V L+ +I LL+IGVP+A A+G +S L++ + S L+ VA ++ + FTLLA+ Sbjct: 1 MLVTLIILFMILLLIIGVPVAFAIGAASLLYIFV-SGYDLSMVAQSMVGGIDS-FTLLAV 58 Query: 61 PFFILASSFMTTGGVARRIIRFSIACVGHLPGGLAIAGVFACMLFAALSGSSPATVVAIG 120 PFF+ + M TGG+ +II + A VGHL GGLA +FA ++F+ LSGS+ A VA+G Sbjct: 59 PFFLFLGAIMNTGGITEKIIDIAKALVGHLKGGLAQVNIFASLIFSGLSGSATADTVALG 118 Query: 121 SIVIAGMRQVGYSKEFAAGVICNAGTLGILIPPSIVMVVYAAAVEVSVGRMFLAGVIPGL 180 S++I M + GY K+FAA + + +G +IPPSI ++++ ++G + +AG+IPGL Sbjct: 119 SVLIPAMEKEGYDKKFAAAITATSSIVGPIIPPSITLIIFGIVTGTAIGPLLIAGIIPGL 178 Query: 181 MAGLMLMVTIYVMAKVKNLPKGEWLGWGEVAASAANASVGLLLIGIILGGIYGGIFTPTE 240 + + LM+ Y ++K + P + E S S LLL II+ GI GIFT TE Sbjct: 179 LVSVSLMIYTYFISKKRGYPSYPKASFKERGRSMYKGSFALLLPIIIVVGIVSGIFTATE 238 Query: 241 AAAVASVYAFFVATFVYRDMGPLKSAPKPKDMGQFLTMLPKMLGQTVVYFIPSFFHADTR 300 +AA+A +YA V+ F+YR + KD+ + T+ Sbjct: 239 SAAIAVLYAVIVSLFIYRTV-------SLKDLWKI-----------------------TK 268 Query: 301 HALFEAGKLTVTLLFVIANALILKHVLTDEQVPQQIATAMLSAGFGPVMFLIVVNVILLI 360 + FE+ K +L +IA A + V+T ++ I+ + S + ++++ V LLI Sbjct: 269 ESTFESAK----ILIIIAAASVFAWVVTRARLSDTISNFLFSFTNNQYVIVLIIIVFLLI 324 Query: 361 GGQFMEPSGLLVIVAPLVFPIAIELGIDPIHLGIIMVVNMEIGMITPPVGLNLFVTSGVA 420 G FM PS +++ AP++ P+ +E+G+DPI G++MV+ + IG +PPVG+ L++ + +A Sbjct: 325 IGLFMLPSEGILVFAPILTPVMVEVGMDPIQFGVLMVLTLTIGGASPPVGIMLYIVTDIA 384 Query: 421 GMPMMAVVRAALPFLAVLFVFLIMITYIPWISTVLPNAVMG 461 + M +V+ +P L V +++ + P +S VL N G Sbjct: 385 RVKYMTLVKEVMPMYIPLIVTAVLVGFFPVLSLVLINFFYG 425 Lambda K H 0.329 0.144 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 553 Number of extensions: 32 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 467 Length of database: 425 Length adjustment: 32 Effective length of query: 435 Effective length of database: 393 Effective search space: 170955 Effective search space used: 170955 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory