Align D-lactate transporter, ATP-binding component (characterized)
to candidate WP_017549708.1 C792_RS0112050 methionine ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF1248 (251 letters) >NCBI__GCF_000330705.1:WP_017549708.1 Length = 340 Score = 111 bits (277), Expect = 2e-29 Identities = 72/245 (29%), Positives = 123/245 (50%), Gaps = 18/245 (7%) Query: 3 ILEVKNVGKRFGG----LQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTG 58 ++E K + K F G + AL D+N+ V + ++ ++G +GAGKSTL+ C+ P G Sbjct: 1 MIEFKGLEKTFEGKHGTVHALKDINMKVGKGEIYGVVGFSGAGKSTLIRCVNYLEQPTAG 60 Query: 59 SVMFDGKSVLGRAPYEIN--QMGISRVFQTPEIFGDLSVLENMMIPCFAKRDGAFEMNAI 116 +V+ DG + + EI + I VFQ + +V N+ +P Sbjct: 61 NVIVDGSDLTRISTKEIRNAKKKIGMVFQHFNLLNSKTVYANIAMPLILDN--------- 111 Query: 117 SAVSGQRDILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPT 176 + + I E+ +L+ + +ADK M +S G K+R+ I L+ P +LL DE T Sbjct: 112 ---APKPKIRERVMELLDFVGLADKAKMYPDQLSGGQKQRIGIARALATRPSILLCDEAT 168 Query: 177 AGMARADTNNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDPQNI 236 + + T++ + LL++I E +ITI +I H+M VV + +R+ V+ G + E I Sbjct: 169 SALDPQTTDSILKLLQKINEEYNITILLITHEMSVVREICNRVAVMEHGNVIEEGTVFEI 228 Query: 237 KGNPK 241 NP+ Sbjct: 229 FSNPQ 233 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 340 Length adjustment: 26 Effective length of query: 225 Effective length of database: 314 Effective search space: 70650 Effective search space used: 70650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory