Align iron(III) dicitrate transport system permease protein FecD (characterized)
to candidate WP_017549748.1 C792_RS0112260 iron ABC transporter permease
Query= CharProtDB::CH_004160 (318 letters) >NCBI__GCF_000330705.1:WP_017549748.1 Length = 330 Score = 175 bits (443), Expect = 2e-48 Identities = 101/322 (31%), Positives = 181/322 (56%), Gaps = 8/322 (2%) Query: 2 KIALVIFITLALAGCALLSLHMGVIPVPWRALLTDWQAGHEHYYVLMEYRLPRLLLALFV 61 K+A+++ + +A+ +L++ + AL+T A V ++R+PR+++ L Sbjct: 6 KLAVLVILLVAVVITSLVTGTFNLTFQDLAALMTG-SADENVMTVFFDFRMPRIIITLVC 64 Query: 62 GAALAVAGVLIQGIVRNPLASPDILGVNHAASLASVGALLLMP---SLPVMVLPLLAFAG 118 GAALAV+G+++Q I RN LA P I+GVN + V + + + + LP+++FAG Sbjct: 65 GAALAVSGLILQAISRNALADPGIIGVNAGSGFGVVLFITFVSGSLTQHLYALPIMSFAG 124 Query: 119 GMAGLILLKMLAKTHQPMK---LALTGVALS-ACWASLTDYLMLSRPQDVNNALLWLTGS 174 G+ ++++ L+ K L G+A + + + L + + + G+ Sbjct: 125 GLLTVLIIFSLSFMSGEFKSNIFILIGIATAMGVTGFVYVFTSLFDTEQMEMLNRYFAGN 184 Query: 175 LWGRDWSFVKIAIPLMILFLPLSLSFCRDLDLLALGDARATTLGVSVPHTRFWALLLAVA 234 +WG W+FV +++P +++ L L S R++D+L L D T G++V + ++LA Sbjct: 185 IWGDTWAFVLVSVPYILIILVLVYSRLREMDMLNLDDEMLTGFGMNVNREKIVLIVLAAM 244 Query: 235 MTSTGVAACGPISFIGLVVPHMMRSITGGRHRRLLPVSALTGALLLVVADLLARIIHPPL 294 ++S V+ CG ISFIGL+ PH+ R + G + L S + GALLL ADLL +++ P+ Sbjct: 245 LSSLAVSVCGAISFIGLIAPHISRMMFGHNMKFLFFASFVMGALLLTTADLLGKLLLAPM 304 Query: 295 ELPVGVLTAIIGAPWFVWLLVR 316 +P G++ ++IG P+FVWLL+R Sbjct: 305 IIPAGIVVSLIGGPYFVWLLLR 326 Lambda K H 0.330 0.142 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 330 Length adjustment: 28 Effective length of query: 290 Effective length of database: 302 Effective search space: 87580 Effective search space used: 87580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory