Align N-succinylglutamate 5-semialdehyde dehydrogenase; EC 1.2.1.71; Succinylglutamic semialdehyde dehydrogenase; SGSD (uncharacterized)
to candidate WP_017547542.1 C792_RS0100830 aldehyde dehydrogenase family protein
Query= curated2:Q87L22 (485 letters) >NCBI__GCF_000330705.1:WP_017547542.1 Length = 475 Score = 189 bits (481), Expect = 1e-52 Identities = 139/455 (30%), Positives = 224/455 (49%), Gaps = 21/455 (4%) Query: 4 WIAGEWVQGQGEEFVS-LSPYNQEVIWRGNGATAEQVDQAVAAARAAFVEWKKRPFAERE 62 +I GEWV+ E ++ ++P + R A VD+AV AA ++E++ P ER Sbjct: 8 YINGEWVESSSGETINVINPATGDAFGRIAKGNAADVDKAVNAAHDVYIEFRNTPVEERR 67 Query: 63 AIVLAFAEKVKENSEKIAEVIAKETGKPIWETRTEAAAMAGKIAISIRAYHDRTGEATRE 122 ++ + + + + E I E G PI ++ M + R D E Sbjct: 68 EMLDRIVNEYENRKDDLIEAITDELGSPIDKSEKVHYQMGLNHFAAARDALDSF--EFEE 125 Query: 123 AAGNQIVLRHRPLGVMAVFGPYNFPGHLPNGHIVPALLAGNTVVFKPSEQTPWTGELAMK 182 G +V++ +GV + P+NFP + + + A AG+ V+ KPSE+TP+ + + Sbjct: 126 QRGENLVVKEA-IGVAGLITPWNFPTNQTSLKLAAAFAAGSPVILKPSEETPFASVILAE 184 Query: 183 LWEEAGLPKGVINLVQGAKE-TGIALADAKGIDGILFTGSANTGHILHRQFAGQPGKMLA 241 ++++AG+PKGV NLV G E G L++ + + FTGS TG + + A K ++ Sbjct: 185 IFDKAGVPKGVFNLVNGDGEGVGNPLSEHPKVRMMSFTGSGRTGAKIMEK-ASADFKKVS 243 Query: 242 LEMGGNNPMVISDNYGDLDATVYTIIQSAFISAGQRCTCARRLYVPFGEKGDALITKLVE 301 LE+GG +P++I D+ ++D +T +Q + GQ CT R +P K D + K+ E Sbjct: 244 LELGGKSPLIILDD-ANVDDAAFTAVQKVVNNTGQVCTAGTRTLIPESMK-DEFLEKVKE 301 Query: 302 ATKNIRMDQPFAEPAPFMGPQISVAAAKFI-------LDAQANLQSLGGESLIEAKAGEA 354 +++++ P E MGP IS + ++ A L GG E A E Sbjct: 302 KMEDVKVGNP-REEGVKMGPLISRKQYDTVQSYINKGVEEGATLYH-GGADQPEGLA-EG 358 Query: 355 AFVSPGII-DVTNIAELPDEEYFGPLLQVVRYEGLDKAVELANDTRFGLSAGLVSTDDQE 413 +V P + DV N + EE FGP++ V+ Y+ LD+A+ LANDT++GL+ + D + Sbjct: 359 FYVKPTVFSDVDNKMTIAQEEIFGPVMSVITYKDLDEAIALANDTKYGLAGYVFGEDPET 418 Query: 414 WEYFVDHIRAGIVNRNRQLTGASGDAPFGGPGASG 448 + I AG V N GA D PFGG SG Sbjct: 419 LKKVARSIEAGTVEINNAKGGA--DLPFGGYKQSG 451 Lambda K H 0.316 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 558 Number of extensions: 32 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 485 Length of database: 475 Length adjustment: 34 Effective length of query: 451 Effective length of database: 441 Effective search space: 198891 Effective search space used: 198891 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory