Align L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 (characterized)
to candidate WP_017549841.1 C792_RS0112730 zinc-binding alcohol dehydrogenase family protein
Query= SwissProt::Q8U259 (348 letters) >NCBI__GCF_000330705.1:WP_017549841.1 Length = 338 Score = 168 bits (426), Expect = 2e-46 Identities = 118/335 (35%), Positives = 176/335 (52%), Gaps = 15/335 (4%) Query: 5 MVAIMKTKPEYGAELVEVDVPKPGPG-EVLIKILATSICGTDLHIYEWNEWAQTRIRPPQ 63 M AI KP +VE++ P G EV++KI ICG+D+HIY + + P+ Sbjct: 1 MKAIQVEKPGQ-LNIVELEKPVIENGDEVIVKIKNVGICGSDVHIYHGSNPFTSY---PR 56 Query: 64 IMGHEVAGEVVEVGPGVEGIEVGDYVSVETHIVCGKCYACKRGQYHVCQNTKIFGVDTDG 123 ++GHEV+G V +VG V + GD V++E CG+CYAC+ GQ +VC + ++FGV DG Sbjct: 57 VIGHEVSGIVEQVGEAVTSLAPGDLVALEPITYCGECYACRNGQPNVCDSLEVFGVHRDG 116 Query: 124 VFAEYAVVPAQNVWKNPKNIPPEYATLQEPLGNAVDTVLAGPI-AGKSVLITGAGPLGLL 182 AEY N K P N+ E A L EP+ G + G +V + GAGP G+ Sbjct: 117 GMAEYLKADENNWHKVPGNVSEEAAALMEPMTIGAQATYRGDVREGDTVFVIGAGPTGIA 176 Query: 183 GIAVAKASGAYPVIVSEPSEFRRNLAKKVGADYVINPFEEDVVKEVMDITDGNGVDVFLE 242 + AK GA V +S+ ++ R + AK +GAD I P V +E+ +T+G +V ++ Sbjct: 177 CLLQAKQRGA-KVFISDFNQNRLDYAKSIGADATIQPDGVHVEEEINRLTNGELANVVID 235 Query: 243 FSGAPKALEQGLQAVTPAGRVSLLGLFPGKVSIDFNNLIIFKALTVYGITGRHLWETWYT 302 G P+ +Q ++ + AGRV LG SI + L+ K L V G +T Sbjct: 236 AVGLPQTFQQAVELASIAGRVVTLGFNEQPSSIP-SLLLTKKELKVAG----SRLQTHQF 290 Query: 303 VSRLLQSGKLNIDP--IITHKYKGFDKYEEAFELM 335 + Q G+ IDP II+ +Y D+ +AFEL+ Sbjct: 291 PKVIDQVGRGEIDPTQIISQRY-SMDQIHDAFELL 324 Lambda K H 0.318 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 276 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 348 Length of database: 338 Length adjustment: 29 Effective length of query: 319 Effective length of database: 309 Effective search space: 98571 Effective search space used: 98571 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory