Align Putative PTS system sugar phosphotransferase component IIA (characterized, see rationale)
to candidate WP_017548976.1 C792_RS0108145 PTS glucose transporter subunit IIA
Query= uniprot:Q9KZP2 (149 letters) >NCBI__GCF_000330705.1:WP_017548976.1 Length = 167 Score = 96.3 bits (238), Expect = 2e-25 Identities = 53/144 (36%), Positives = 82/144 (56%), Gaps = 4/144 (2%) Query: 4 VSSPLAGRAIGLAAVPDPVFSGAMVGPGTAIDPVREPSEAVAPVDGVIVSLHP--HAFVV 61 + SP+ G + L +PDPVF+ M+G G IDP E VAPVDGVI+ + P HA + Sbjct: 19 IKSPMNGSYVPLEDIPDPVFAEKMMGEGFGIDPSH--GEVVAPVDGVIMQVFPTNHAIGI 76 Query: 62 VDESGHGVLTHLGIDTVQLNGEGFELLVNKGDTVVRGQGVVRWDPAAVEAAGKSPICPIV 121 ++G VL H+G++TV + G+GFE V++GD + G +V +D V+ S I P++ Sbjct: 77 KTDNGVEVLIHIGLETVAMEGKGFEGFVSEGDRIEVGDKLVTFDIDLVKEEANSTISPVI 136 Query: 122 ALEATAEALADLREDGDVKAGESL 145 + A D++ D GE++ Sbjct: 137 ITNSDELASFDIQSVSDTVKGETV 160 Lambda K H 0.316 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 102 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 149 Length of database: 167 Length adjustment: 17 Effective length of query: 132 Effective length of database: 150 Effective search space: 19800 Effective search space used: 19800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory